KEGG   Paracoccus denitrificans: Pden_1363Help
Entry
Pden_1363         CDS       T00440                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
pde  Paracoccus denitrificans
Pathway
pde00630  Glyoxylate and dicarboxylate metabolism
pde01100  Metabolic pathways
pde01110  Biosynthesis of secondary metabolites
pde01120  Microbial metabolism in diverse environments
pde01200  Carbon metabolism
Module
pde_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:pde00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Pden_1363
Enzymes [BR:pde01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Pden_1363
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ABL69464
JGI: Pden1363
UniProt: A1B1S0
Position
1:complement(1328565..1330172)
Genome map
AA seq 535 aa AA seqDB search
MSRKTFSEIHAEVSSRYPSGRTPGGVSVDDIVQLRLQNTYDTHLDIARDMAGVMRADMAA
YDADAAQFTQSLGCWSGFHAQQMIKAVKRLRGTARGTYVYLSGWMVAGLRNRWGHLPDQS
MHEKTAVADLIQEIYVSLRQADEVALNDLFKDLKAAKTEAERAKAIAAIDGFESHVVPII
ADIDAGFGNEHATYLLAKELIKAGACALQIENQVSDAKQCGHQDGKVTVPREDFIEKLRA
CRLAFEELGVDDGVIVARTDSLGAGLTQKVPVSQRLGDLAAEYIKWLKVEPITEANPIRE
GELALFKDGQFVKPARLPNGLFPFQENTGRQRVIEDCIASLTQGGADLLWIETDTPNVDE
IAGMVAEIRKAVPNAKLTYNNSPSFNWTLNLRKQVRAQWLAEGSIAEADYPDGNELMKPD
FDDTDLGREADARLQRFQTDISARAGVFHNLITLPTFHLTAKSVDELSHGYFGEEKMLAY
VKTVQRQEIRRGISAVKHQHEVGSDLGDSFKEMVAGERALKAGGHANTMNQFAAE
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgagcagaaagactttttcggaaatccatgccgaggtgtcgtcccgctacccctccggt
cgaaccccgggtggcgtttcggtcgatgacatcgtgcagctgcggctgcagaacacctat
gacacgcatctggacatcgctcgcgacatggccggcgtgatgcgcgcggacatggcggcc
tatgacgccgatgccgcgcagttcacccagtcgctgggctgctggtcgggctttcacgcc
cagcagatgatcaaggcggtcaagcgcctgcgcggcacggccaggggcacctatgtctat
ctgtcgggctggatggtcgcgggcctgcgcaaccgctggggccatctgcccgaccagtcc
atgcatgaaaagaccgccgtggccgacctgatccaggagatctacgtctcgctgcgccag
gccgacgaggtggcgctgaacgacctgttcaaggatctcaaggccgcgaagaccgaggcc
gagcgggcgaaggccatcgcggcgatcgacggtttcgaatcccatgtcgtgccgatcatc
gccgatatcgacgcgggcttcggcaacgaacacgccacctatctgctggccaaggaactg
atcaaggccggcgcctgcgcgctgcagatcgagaaccaggtctcggacgccaagcaatgc
ggccaccaggacggcaaggtcacggtcccgcgcgaggatttcatcgaaaagctgcgcgcc
tgccgcctggccttcgaggagctgggcgtggacgatggcgtcatcgtcgcccgcaccgac
agcctgggcgccgggctgacgcagaaggtgccggtcagccagcgcctgggcgacttggcc
gcggaatacatcaaatggctgaaggtcgagccgatcaccgaggcgaacccgatccgcgag
ggcgagctggcgctgttcaaggacgggcagttcgtgaagccggcccggcttccgaacggg
ctgttcccgttccaggaaaacaccggccgccagcgcgtgatcgaggattgcatcgccagc
ctgacccagggcggcgccgacctcctgtggatcgagaccgacacgccgaacgtcgatgag
atcgccggcatggtggccgagatacgcaaggcggtgccgaacgccaagctgacctacaac
aactcgcccagcttcaactggacgctgaacctgcgcaagcaggtgcgcgcgcaatggctg
gccgagggcagcattgccgaggccgactacccggacggcaacgagctgatgaagcccgat
ttcgacgataccgacctgggacgcgaggccgacgcccggctgcaacgcttccagaccgat
atctcggcccgggccggcgtgttccacaacctgatcacgctgccgaccttccacctgacc
gccaagtcggtggacgagctgtcgcacggctatttcggcgaggaaaagatgctggcctat
gtgaagaccgtgcagcgccaggagatccgccgcggcatctcggcggtcaagcatcagcac
gaggtcggctcggacctgggcgacagcttcaaggagatggtcgcgggcgagcgtgcgctg
aaggcgggcgggcacgccaacaccatgaaccagttcgccgccgaatag

DBGET integrated database retrieval system