KEGG   Paracoccus denitrificans: Pden_1364Help
Entry
Pden_1364         CDS       T00440                                 

Definition
(RefSeq) malate synthase
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
pde  Paracoccus denitrificans
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:pde00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pden_1364
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Pden_1364
   00630 Glyoxylate and dicarboxylate metabolism
    Pden_1364
Enzymes [BR:pde01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Pden_1364
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(1330296..1331918)
Genome map
AA seq 540 aa AA seqDB search
MPLDRNATTLPPVVLRAVPGADHVLTPEALGFVAELQDRFGLRLHALMVARARRQERIDR
GELPDYLPQTREIRQGIWQAAPVPPALEDRRVEITGPVDRKMMINALNSGARVFMADFED
ATAPSFANIIAGQANLIDYRDGTLEHDDSATGKSYRVGPRPALLIVRPRGLHLPEANVLI
GGQPVSAALFDFGLSLYHCGRALAATGRGPFYYLPKLEGHGEARFWNEVFAFAQDRMGLA
QGTIKATVLIETLPAAFEMDEIVWELRDHIAGLNCGRWDYIFSYIKTLRNHPAYALPDRA
QVGMENAFLAAYAARVVKVCHRRGIHAMGGMSAAIPVRGDAEANEAAFARVRADKQREVG
MGFDGCWVAHPDLVPVAQAVFDAAMPGPNQIRKPRQQWRIEPAMLLKPHRGRITEAGVRL
NIEVAVEYLAQWLSGRGAVPIQNMMEDAATAEISRAQLWQWLRHGAPVVLENGEERRLTA
EWLGELMQAEIVRILDRLGPNGFHRGHYASAARIVQEAATAETLPDFITVPAYDVLNALD
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgccgctcgaccgcaatgccaccacgctaccgcccgtcgtcctgcgcgccgtgccgggc
gcggatcacgtcctgacccccgaggcgctgggtttcgtcgccgaattgcaggaccgcttc
ggcctgcggctgcatgcgctgatggtcgcccgcgcccgccggcaggagcgcatcgaccgg
ggtgagttgcccgactacctgccgcagacgcgcgagatccggcagggcatctggcaggcc
gcccccgtcccgccggcgctggaggatcgccgggtcgagatcaccggcccggtggatcgc
aagatgatgatcaacgcgctgaactcgggcgcccgggtcttcatggccgatttcgaggac
gcgaccgcgcccagcttcgccaatatcatcgccgggcaggcgaacctgatcgactatcgc
gacggcacgctggagcatgacgactctgccaccggcaagagctatcgcgtcggcccccgc
ccggcgctgctgatcgtccgcccgcgcgggctgcacctgcccgaggcgaatgtgctgatc
ggcggccagccggtctcggcggcgctgttcgatttcggcctgtcgctttatcactgcggc
cgggcgctggccgccaccgggcgcgggccgttctattacctgcccaagctggagggccat
ggcgaggcgcggttctggaatgaggtctttgcctttgcccaggaccgcatgggactggcg
cagggcacgatcaaggccaccgtgctgatcgagaccctgcccgccgccttcgagatggac
gagatcgtctgggaactgcgcgaccacatcgccgggctgaattgcggccgctgggactat
atcttcagctatatcaagacgctgcgcaatcatccggcctatgcgctgcccgaccgggcg
caggtcgggatggagaatgccttcctggccgcctatgccgcccgcgtggtcaaggtctgc
catcgccgcggcatccatgccatgggcggcatgtcggcggcgatcccggtccggggcgat
gccgaggccaacgaggccgcctttgcccgcgtccgcgccgacaagcaacgcgaggtcggc
atgggcttcgacggctgttgggtcgcgcatcccgacctggtgccggtggcgcaggcggtc
ttcgacgccgccatgcccggtccgaaccagatccgcaagccgcgccagcaatggcgcatc
gagcccgcgatgctgctgaaaccccatcggggccggatcaccgaggcgggcgtgcggctg
aatatcgaggtcgccgtcgaatacctggcgcaatggctgtccggccgcggcgcggtgccg
atccagaacatgatggaggatgccgccaccgccgagatcagccgcgcccagctgtggcaa
tggctgcgccacggcgcccccgtcgtgctggagaacggcgaagagcgccggttgaccgcc
gaatggctgggcgagttgatgcaggccgagatcgtccgcatcctcgaccggctgggcccg
aacgggttccatcgcggccattacgccagcgccgcgcgtatcgtgcaggaggccgcgacg
gccgagaccctgcccgatttcatcaccgtcccggcctacgacgtgctgaacgcgctggac
tga

DBGET integrated database retrieval system