KEGG   Paracoccus denitrificans: Pden_1364Help
Entry
Pden_1364         CDS       T00440                                 

Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
pde  Paracoccus denitrificans
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:pde00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pden_1364
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Pden_1364
   00630 Glyoxylate and dicarboxylate metabolism
    Pden_1364
Enzymes [BR:pde01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Pden_1364
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(1330296..1331918)
Genome map
AA seq 540 aa AA seqDB search
MPLDRNATTLPPVVLRAVPGADHVLTPEALGFVAELQDRFGLRLHALMVARARRQERIDR
GELPDYLPQTREIRQGIWQAAPVPPALEDRRVEITGPVDRKMMINALNSGARVFMADFED
ATAPSFANIIAGQANLIDYRDGTLEHDDSATGKSYRVGPRPALLIVRPRGLHLPEANVLI
GGQPVSAALFDFGLSLYHCGRALAATGRGPFYYLPKLEGHGEARFWNEVFAFAQDRMGLA
QGTIKATVLIETLPAAFEMDEIVWELRDHIAGLNCGRWDYIFSYIKTLRNHPAYALPDRA
QVGMENAFLAAYAARVVKVCHRRGIHAMGGMSAAIPVRGDAEANEAAFARVRADKQREVG
MGFDGCWVAHPDLVPVAQAVFDAAMPGPNQIRKPRQQWRIEPAMLLKPHRGRITEAGVRL
NIEVAVEYLAQWLSGRGAVPIQNMMEDAATAEISRAQLWQWLRHGAPVVLENGEERRLTA
EWLGELMQAEIVRILDRLGPNGFHRGHYASAARIVQEAATAETLPDFITVPAYDVLNALD
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgccgctcgaccgcaatgccaccacgctaccgcccgtcgtcctgcgcgccgtgccgggc
gcggatcacgtcctgacccccgaggcgctgggtttcgtcgccgaattgcaggaccgcttc
ggcctgcggctgcatgcgctgatggtcgcccgcgcccgccggcaggagcgcatcgaccgg
ggtgagttgcccgactacctgccgcagacgcgcgagatccggcagggcatctggcaggcc
gcccccgtcccgccggcgctggaggatcgccgggtcgagatcaccggcccggtggatcgc
aagatgatgatcaacgcgctgaactcgggcgcccgggtcttcatggccgatttcgaggac
gcgaccgcgcccagcttcgccaatatcatcgccgggcaggcgaacctgatcgactatcgc
gacggcacgctggagcatgacgactctgccaccggcaagagctatcgcgtcggcccccgc
ccggcgctgctgatcgtccgcccgcgcgggctgcacctgcccgaggcgaatgtgctgatc
ggcggccagccggtctcggcggcgctgttcgatttcggcctgtcgctttatcactgcggc
cgggcgctggccgccaccgggcgcgggccgttctattacctgcccaagctggagggccat
ggcgaggcgcggttctggaatgaggtctttgcctttgcccaggaccgcatgggactggcg
cagggcacgatcaaggccaccgtgctgatcgagaccctgcccgccgccttcgagatggac
gagatcgtctgggaactgcgcgaccacatcgccgggctgaattgcggccgctgggactat
atcttcagctatatcaagacgctgcgcaatcatccggcctatgcgctgcccgaccgggcg
caggtcgggatggagaatgccttcctggccgcctatgccgcccgcgtggtcaaggtctgc
catcgccgcggcatccatgccatgggcggcatgtcggcggcgatcccggtccggggcgat
gccgaggccaacgaggccgcctttgcccgcgtccgcgccgacaagcaacgcgaggtcggc
atgggcttcgacggctgttgggtcgcgcatcccgacctggtgccggtggcgcaggcggtc
ttcgacgccgccatgcccggtccgaaccagatccgcaagccgcgccagcaatggcgcatc
gagcccgcgatgctgctgaaaccccatcggggccggatcaccgaggcgggcgtgcggctg
aatatcgaggtcgccgtcgaatacctggcgcaatggctgtccggccgcggcgcggtgccg
atccagaacatgatggaggatgccgccaccgccgagatcagccgcgcccagctgtggcaa
tggctgcgccacggcgcccccgtcgtgctggagaacggcgaagagcgccggttgaccgcc
gaatggctgggcgagttgatgcaggccgagatcgtccgcatcctcgaccggctgggcccg
aacgggttccatcgcggccattacgccagcgccgcgcgtatcgtgcaggaggccgcgacg
gccgagaccctgcccgatttcatcaccgtcccggcctacgacgtgctgaacgcgctggac
tga

DBGET integrated database retrieval system