KEGG   Paracoccus denitrificans: Pden_1402Help
Entry
Pden_1402         CDS       T00440                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
pde  Paracoccus denitrificans
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pde00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Pden_1402
Enzymes [BR:pde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Pden_1402
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(1371581..1372072)
Genome map
AA seq 163 aa AA seqDB search
MSNILKLPAVVPVAVSRFWSTPAFPAGSGPEYVNAAASFRCDLPPEQLLHELHMIEKILG
RSREGRRWQARGLDLDLLAHGDLVLPDAAEQDHWRSLPPQEQPLRAPDRLILPHPRLQDR
GFVLAPLAEIAPNWMHPRLGRSVAQMLAALPPEALAGIRPASA
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
ttgtccaacatattgaaattacctgcggttgtgccggtcgccgtcagcagattctggtca
acgccggcttttcctgccggttcgggtcccgaatatgtgaatgcggcggcatcatttcgc
tgcgatcttccgcccgaacaacttctgcacgaattgcacatgatcgagaaaatattgggc
cgcagccgcgaaggccggcgctggcaggcacgcgggctggacctggacctgctggcccat
ggcgatctggtcctgcccgatgccgcagagcaggaccattggcgcagcctgccgcctcaa
gaacagccgctgcgcgcgcccgaccggctgatcctgccccatccccgcctgcaggaccgc
ggtttcgtgctggcgcccctggccgagatcgcgccgaactggatgcatccgcgcctggga
cgcagcgtggcgcagatgctggccgccctgccgcccgaggctttggcggggattcggcct
gcaagtgcttga

  All links  
No link information was found.   
DBGET integrated database retrieval system