KEGG   Paracoccus denitrificans: Pden_1744Help
Entry
Pden_1744         CDS       T00440                                 

Definition
thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
pde  Paracoccus denitrificans
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pde00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Pden_1744
Enzymes [BR:pde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     Pden_1744
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1732864..1733442
Genome map
AA seq 192 aa AA seqDB search
MAKLYFHYSTMNAGKSTLLLQASYNYRERGMATLLLTAALDDRAGAGQIASRIGIAESAL
GFTPEADLFALIRTRGRDAACIFVDEAQFLTEQQVWQLARVADDLGQPVMCYGLRVDFRG
RLFPGSAALLALADDLREVRTICHCGRKATMVVRQDEGGLVLREGAQVQIGGNETYVSLC
RRHWREAMGEIR
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggccaagctttactttcattattccacgatgaacgccggcaagagcacgctcttgctg
caagcgtcctacaactaccgcgagcgcggcatggcgacgctgctgttgaccgcggcgctc
gacgaccgcgccggtgctggccagatcgccagccgcatcggcatcgccgaatccgcgctg
ggcttcacccccgaggccgatcttttcgcgctgatccggacccgcggccgcgacgccgcc
tgcatcttcgtcgacgaggcgcagttcctgaccgagcagcaggtctggcagcttgcccgc
gtcgccgacgatcttggccagccggtgatgtgctacggtctgcgcgtcgatttccgcggc
cggctgtttcccggctcggcggcgctgctggcgctggccgacgacctgcgcgaagtgcgc
accatctgccactgcggacgcaaggccaccatggtcgtgcgacaggacgaagggggcctc
gtgctgcgcgagggcgcgcaggtccagatcggcggcaatgaaacctatgtctcgctctgc
cggcgccattggcgcgaagcgatgggagaaatccgatga

DBGET integrated database retrieval system