KEGG   Paracoccus denitrificans: Pden_1808Help
Entry
Pden_1808         CDS       T00440                                 

Definition
cytochrome c, class I
Orthology
K08738  
cytochrome c
Organism
pde  Paracoccus denitrificans
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Thiosulfate oxidation by SOX complex, thiosulfate => sulfate
Brite
KEGG Orthology (KO) [BR:pde00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Pden_1808
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Pden_1808
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Structure
PDB: 

Jmol
Position
1:complement(1802128..1802658)
Genome map
AA seq 176 aa AA seqDB search
MFDTMTVTKAAGALIGSLLFLLLMSWAASGIFHVGTSGHGAEGEEHAQAYTIPVESAGGA
EGEAVDEGPDFATVLASADPAAGEKVFGKCKACHKLDGNDGVGPHLNGVVGRTVAGVDGF
NYSDPMKAHGGDWTPEALQEFLTNPKAVVKGTKMAFAGLPKIEDRANLIAYLEGQQ
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgttcgataccatgaccgtcaccaaggcagccggtgcgctgatcggctcgcttctgttc
cttctgctgatgagctgggcggcatcgggtatctttcacgtcggcacctcgggccacggc
gccgagggcgaagagcatgcccaggcatataccatcccggtcgagagcgccggcggcgcc
gagggcgaggccgtggacgaaggccccgattttgccaccgtcctggcctcggccgatccc
gccgctggcgagaaggtgttcggcaagtgcaaggcctgccacaagctggacggcaacgat
ggcgtcggcccgcatctgaacggcgtcgtcggccgcacggtcgcaggcgtcgatggcttc
aactattccgacccgatgaaggcgcatggcggcgactggacccccgaggcgctgcaggaa
ttcctgaccaacccgaaagcggtggtcaagggcaccaagatggccttcgccggcctgccc
aagatcgaggatcgcgccaacctgatcgcctatctggaaggccagcagtaa

DBGET integrated database retrieval system