KEGG   Paracoccus denitrificans: Pden_1831Help
Entry
Pden_1831         CDS       T00440                                 

Definition
alpha/beta hydrolase
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
pde  Paracoccus denitrificans
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:pde00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1828605..1829549
Genome map
AA seq 314 aa AA seqDB search
MKPAPFNTLPGDPLPLARAFWLRAEDGVRLRAAHWAAGGASGTVLLFPGRTEYLEKYNDI
AAELNAAGLDVLAPDWRGQGMSDRLQDNTRPGHVGDFADYQRDVVELVVAAQELDLPRPW
HLLAHSMGGAIGLAALDAGLPVESVVFSAPMWGIDLRRVPEAVAMAVARLGIRLGRSGHP
APGSGGEESFVLLDPFHDNLLTGDGRRWGRLVAEAATWPDIAVGGASYGWLRAALLECRR
LAALPSPALPALIALGDRERIVSPHAIRTRVAAWPGATMLDLPDCRHEPMMERDPVRSRF
LEAALAHFESAAAG
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgaagcccgcacccttcaacacgctgcccggcgatccgctccccttggcccgcgccttc
tggctgcgggccgaggacggggtgcggctccgggcggcgcattgggcggcgggcggcgcc
tcggggacggtgctgctgtttccgggccgcacggaatatctagagaaatacaacgacatc
gcggcagaattgaatgccgccgggctggacgtgctggcaccggactggcgcggccagggc
atgtccgaccgattgcaggacaatacccgccccggccatgtcggcgatttcgccgattac
cagcgcgacgtggtcgaactggtcgtcgccgcgcaggaactggacctgccccggccctgg
catcttctggcgcattccatgggcggcgccatcggccttgcggcgctggatgccgggctg
ccggtggaaagcgtggtcttctcggcgccgatgtggggcatcgacctgcgccgcgtgccg
gaagccgtcgccatggccgtcgcccggcttggcatccggctgggccggagcggccatccc
gctcccggctcggggggcgaggaaagcttcgtgctgctggaccctttccacgacaacctg
ctgaccggggacggccggcgctggggccggctggtggccgaggccgccacctggcccgat
atcgcggtcggcggcgccagctacggctggctgcgcgcggcgcttctggaatgccgccgc
ctcgccgccctgccctcgccggcactgccggcgctgatcgcgcttggcgatcgcgagcgg
atcgtctcgccccatgccatccgcacccgcgtcgccgcctggcccggcgccaccatgctg
gacttgcccgattgccggcatgagccgatgatggagcgcgaccccgtccgcagccgcttt
cttgaagccgccctcgcccatttcgagtccgccgcggcgggctga

DBGET integrated database retrieval system