KEGG   Paracoccus denitrificans: Pden_2139Help
Entry
Pden_2139         CDS       T00440                                 

Definition
indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
pde  Paracoccus denitrificans
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pde00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Pden_2139
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Pden_2139
Enzymes [BR:pde01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Pden_2139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2140366..2141157
Genome map
AA seq 263 aa AA seqDB search
MDILDRIKAYKLQEIAAAKAARPLAGIEAAAREASPPRGFAAALTDKAAQGHALIAEIKK
ASPSKGLIRPDFDPPALARAYQAGGAACLSVLTDGPSFQGAPEFLTAARDACDLPALRKD
FLYDPYQVAEARAWGADCILIIMASVDDTLAAELEDAALHWGMDALVEVHDREELDRALR
LKSPLIGVNNRNLKTFEVSLDTTLDLAPHVPAERDLVCESGLFTPSDLNRMAEAGVRRFL
IGESLMRQQDVTAATRSILGLAA
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggatattctcgaccgcatcaaggcctacaagcttcaggaaatcgccgccgccaaggcc
gcccggccgctggccggcatcgaggccgcggcccgcgaagcatcgcccccccgcggcttt
gccgccgcgctgaccgacaaggccgcgcagggccatgcgctgatcgccgagatcaagaag
gccagcccctccaaagggttgatccgcccggatttcgacccgccggcactggcccgcgcc
tatcaggcgggtggcgccgcctgcctttcggtgctgaccgacggccccagctttcagggc
gcgccggaattcctgaccgccgcgcgcgatgcctgcgacctgccggcgctgcgcaaggat
ttcctctacgatccgtatcaggtggccgaggcccgcgcctggggcgccgattgcattctg
atcatcatggcctctgtcgatgacacgcttgccgccgagctggaggacgcggccctgcat
tggggcatggatgcgctggtcgaggttcacgaccgcgaggaactggaccgcgccttgcgg
ctgaaatcgccgctgatcggggtgaacaaccgcaatctcaagaccttcgaggtcagcctg
gacaccacgctggacctggcgccgcatgtgccggccgagcgcgatctggtctgcgagagc
gggctgttcacgccttccgacctgaaccgcatggccgaggcgggggtcaggcgcttcctg
atcggcgaaagcctgatgcgccagcaggacgtgaccgccgccacccgcagcatcctgggc
ctcgcggcatga

DBGET integrated database retrieval system