KEGG   Paracoccus denitrificans: Pden_2222Help
Entry
Pden_2222         CDS       T00440                                 

Gene name
deoA
Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
pde  Paracoccus denitrificans
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pde00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Pden_2222 (deoA)
Enzymes [BR:pde01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Pden_2222 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2221769..2223061)
Genome map
AA seq 430 aa AA seqDB search
MSPAGPGHDPRPVIAAVRDGRGLDAAGAALVARGLADGSVSDAQAAAFAMAVLTRGLDEA
GRVALTRAMRDSGHVLRWDLPGPVVDKHSTGGIGDAVSLILAPLVASCGAYVPMISGRGL
GHTGGTLDKLEAIPGFRTALSEDDFRRVVAEVGCAIVAAGPELAPADARLYAIRDESATV
GSIDLITASILSKKLAAGLDALVLDVKQGSGAFLRSPDAALALARALVDTAKGAGCRTRA
YVTDMDQPLARAAGNALELREAIAVLTGEQGALRDLSLALSSACLDLGGLADGALRALDG
GAAAERFARMVVAQGGPADLLEHPERHLPPAPVVRAVPGHGRVVAIDTEVLGHAVVALGG
GRLHAGDRIDPRVGLAELLRIGEEAGPGRPLALVHAASDAAADAAVATVAAAYLLGDGPE
PGPLIRSEVT
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgagccctgccggccccggccacgacccgcgtccggtgatcgccgccgttcgcgacggg
cgcgggctggacgcggcgggcgcggcgctggtcgcgcgcggcctggccgacggttcggtc
agcgatgcgcaggccgcggcctttgccatggcggtgctgacgcgcggtctggacgaggcg
gggcgggtggcgttgacccgggccatgcgcgattccggccatgtgctgcgctgggatctg
ccggggccggtggtggacaagcattcgaccggcggcatcggcgatgcggtcagcctgatc
ctggccccgctggtggcgagttgcggcgcctatgtgccgatgatctcggggcgcgggctg
ggccataccggcggcacgctggacaagctggaggcgatccccggcttccgcaccgcgctg
tccgaggacgatttccgccgcgtggtggccgaggtcggctgcgccatcgtcgcggccggg
ccggaactggcgccggccgatgcgcggctttacgcgatccgcgacgaaagcgcgacggtg
ggctcgatcgaccttatcaccgcctcgatcctgtccaagaagctggcggcggggctggat
gcgctggtgctggacgtcaagcaaggcagcggcgcctttctgcgcagcccggatgcggcg
ctggcgctggcccgcgcgctggtcgataccgcgaagggtgccggctgccgcacccgcgcc
tatgtcaccgacatggatcagccgctggcgcgcgccgccggcaatgcgctggaactgcgc
gaggccatcgccgtgctcacgggcgaacagggggcgttgcgcgacctgtcgctggcgctg
tcctcggcctgcctcgatcttggcggcttggccgacggcgccttgcgggcgctggacggc
ggcgccgcggccgagcgtttcgctcgcatggtggtcgcgcagggcgggccggccgacctg
ctcgaacatcccgagcgccacctgccgcccgcgccggtggtgcgcgccgtgcccggccat
ggccgcgtcgtcgccatcgataccgaggtgctgggccatgccgtggtggcgctgggcggt
gggcggctgcatgccggtgaccggatcgaccctcgggtggggcttgcggaactgctccgc
atcggcgaggaggcgggtccgggtcgtcccctggcgctggtccatgccgcttccgatgcg
gcggccgatgcggcggtcgccactgtcgcggccgcctatctgctgggcgatggcccggag
cccggcccattgatccgcagcgaggtaacatga

DBGET integrated database retrieval system