KEGG   Paracoccus denitrificans: Pden_2300Help
Entry
Pden_2300         CDS       T00440                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
pde  Paracoccus denitrificans
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:pde00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2297697..2298494)
Genome map
AA seq 265 aa AA seqDB search
MQFDRMIAEMRRLALRAGDEIMKIYGAEDFDVRAKADASPVTEADEAADALISAGLRAAF
PDIPLVTEEQAETHGQSLSTFLIVDPLDGTKEFVQRRGDFTVNIAYVENGVPRLGVVYAP
AKGRLFYTTAQGGSVEEKGPFGEEPGEVTPIGVNSMPDNRALMVVASKSHRDAATDAYIA
RYGVRDMTSAGSSLKFCLVATGEADLYPRLGRTMEWDTAAGDAVLRGAGGEVVRFDDHAA
LAYGKPGFENPFFIAFAPGVLLVKD
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgcaattcgatcgaatgattgccgaaatgcgacgtctcgccctgcgcgccggcgacgag
atcatgaagatctacggtgccgaggatttcgacgtgcgcgcgaaggccgacgcctcgccc
gtgaccgaggccgacgaggccgccgatgcgctgatttcggccgggctgcgcgctgcattc
cccgacatcccgctggtgaccgaggaacaggccgagacccacggccaaagcctgtcgacc
tttctgatcgtcgatccgctggacggcaccaaggaattcgtgcagcgccgcggcgacttc
accgtcaacatcgcctatgtcgagaacggcgtgccgcggctgggcgtggtctatgcgccg
gccaaggggcggctgttctacaccaccgcgcagggcggctcggtcgaggaaaagggcccc
ttcggcgaagagccgggcgaggtcacgcccatcggcgtcaattccatgcctgacaaccgg
gcgctgatggtcgtcgcctcgaaatcgcatcgcgacgcggcgaccgacgcctatatcgcc
cgctacggcgtgcgcgacatgacctcggcgggcagctcgctgaaattctgcctggtggcg
acgggcgaggccgatctctacccgcggctgggccgcaccatggaatgggacaccgccgcc
ggcgacgccgtgctgcgcggcgcggggggcgaggtggtgcgtttcgacgaccatgccgcc
ctggcctatggcaagccgggattcgaaaacccgttcttcatcgccttcgccccgggcgtg
ctgctggtcaaggattga

DBGET integrated database retrieval system