KEGG   Paracoccus denitrificans: Pden_2308Help
Entry
Pden_2308         CDS       T00440                                 

Definition
(GenBank) Ribokinase
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
pde  Paracoccus denitrificans
Pathway
pde00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pde00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Pden_2308
Enzymes [BR:pde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Pden_2308
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin Pro_dh-DNA_bdg
Motif
Other DBs
NCBI-ProteinID: ABL70399
JGI: Pden2308
UniProt: A1B4F5
Position
1:2307311..2308180
Genome map
AA seq 289 aa AA seqDB search
MTIYNLGSINIDHVYRLPALPRPGETLHAQSYAQGLGGKGANQSVAAARAGADVVHLGAM
AASDGWVLGRLAEAGVQTSAIARLPDIATGHAIILVDTAGENSIVLHGGANLALPAALAS
GIGFGPDDILLMQNETNLQAETAALARRAGARVIYSAAPFSIAALREVLPHVSILSVNEI
EARDTFAAFGEDLPVEGLLVTRGAEGAEFRDLRGGQAWHQPAFAVEAVDTTGAGDCFTGW
FAAGLARGENPPTALRHAAAAAALQVTRRGAGDAMPDRTEVLAFLKARG
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgacgatctacaatctcggctcgatcaacatcgatcacgtctatcgcctgcccgccctg
ccccgcccgggcgagacgctgcacgcgcaatcctatgcccaggggctgggcggcaagggt
gccaaccagtcggtcgccgccgcccgagccggggccgatgtcgtccatctgggcgccatg
gccgcgagcgacggctgggtgcttgggcggcttgccgaggcgggtgtccagacctcggcc
atcgcccggctgccggacatcgccaccggccatgcgatcatcctggtcgataccgcgggc
gagaactcgatcgtgctgcatggcggcgccaacctcgccctgccggcggccctggccagc
ggcatcggctttggcccggacgacatcctgctgatgcagaacgaaaccaacctgcaggcc
gaaaccgccgcgctggcccgtcgggcgggcgcgcgggtgatctattccgccgcccccttc
agcatcgcggcgctgcgcgaggttttgccgcatgtttcgatcctgtcggtgaacgagatc
gaggcccgcgacaccttcgccgccttcggcgaggatctgcccgtcgagggcctgctggtc
acccgcggcgccgagggggccgaattccgcgacctgcgcggcgggcaggcctggcaccag
ccggcctttgcggtagaggcggtggatacgaccggcgccggggattgctttaccggttgg
ttcgccgccgggctggcacggggcgagaacccgccgaccgccctgcgccatgcagcagcc
gcagcggcgctgcaagtcacccgcaggggcgccggcgatgccatgcccgaccgcaccgaa
gtcctcgcttttctgaaagcccgcggctga

DBGET integrated database retrieval system