KEGG   Paracoccus denitrificans: Pden_2458Help
Entry
Pden_2458         CDS       T00440                                 

Definition
(GenBank) protein phosphatase 2C domain protein
Organism
pde  Paracoccus denitrificans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1:complement(2469372..2470148)
Genome map
AA seq 258 aa AA seqDB search
MPAKDHPVNGPTTRRGLSVRGAGLTHRGAVRDQNEDAILVDPSGRVWAVADGMGGHRLGG
YASDRVIDALETIADSEEPAEALAARFAAADVLIAERGRREGAVIGATAVAAIIRRGRLT
LAWAGDARAYLLRDGGLALLTRDHSLVQEWVDAGRLAPEAARGHPQANIVTRAVGAGAAP
EFVALDLVVGDRLLLCSDGLTHVLPDDALAAALRDTRPGAAPGAGTPADAACARLVQQTL
AAGAPDNVSVIVVDIGPG
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
ttgcctgcaaaggatcacccggtgaacggtcccaccacccggcgcgggctgtcggttcgg
ggcgccgggctgacccatcgcggcgcggtgcgcgaccagaacgaggacgcgatcctggtc
gatccctcgggccgggtctgggcggtggcggacggcatgggcggacaccggctgggcggc
tatgcctcggaccgggtgatcgacgcgctggaaaccatcgccgacagcgaagaacccgcc
gaggcgctggccgcgcgctttgcggcggcggatgtgctgatcgcagagcggggccggcgc
gagggtgcggtgatcggcgccaccgccgttgcggcgatcatccggcgcggccggctgacg
ctggcctgggcgggggacgcgcgggcctatctgctgcgcgacggcgggctggccctgctg
acccgcgaccattcgctggtgcaggaatgggtggatgccggccggctggcgcccgaggcg
gcgcgcggccatccgcaggccaatatcgttacccgcgccgtgggggcgggggcggcgccg
gaattcgtcgcgctggacctggtcgtgggggaccggctgctgctgtgttcggacgggctg
acgcatgtgctgcccgacgatgcgctggccgcggcgctgcgggacacccgccccggcgcc
gcgccgggtgccggcacgcccgccgatgccgcctgtgcccggctggtgcagcagacgctg
gccgcgggggcgcccgacaatgtttcggtcatcgtcgtcgacatcgggccgggctga

DBGET integrated database retrieval system