KEGG   Paracoccus denitrificans: Pden_2618Help
Entry
Pden_2618         CDS       T00440                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
pde  Paracoccus denitrificans
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:pde00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2632922..2634409)
Genome map
AA seq 495 aa AA seqDB search
MTHILAIDQGTTSSRAILFDAGLRVVSSAQHEFPQHYPFSGWVEHDASDLWVTVAGVARA
AVEKAGLHAGDIAAIGITNQRETTLLWDRRTGQPLHRAIVWQDRRTAGLCDRLRAEGHEP
MIAARTGLLLDPYFSGSKLKWLLDNIDGARARARRGELAFGTVDSWLIWNLTGGRVHATD
ATNAARTLLYNIAENRWDAEICALFDIPMPLLPEVRDCAADFGMARADLFGREIPILGVA
GDQQAATVGQACFQPGMMKSTYGTGCFALLNTGEEMVASKNRLLSTIAYRLEGRTTYALE
GSIFIAGAVVQWLRDGLGLIRSAAETQGLAEAADPGQELVLVPAFTGLGAPYWRPDCRGA
VFGLTRNSGPAELARAALESVGFQTRDLWEAMRADWPGAAAGVLRVDGGMAASGWTMQFL
ADILGAPVDRPRVTETTALGAGYLAGLQAGLCPPPGDFARDWALERRFEPAMAEGERETR
YGRWKQAVKATMGVA
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgacccatatcctcgccatcgaccagggcaccacgtcctcgcgcgcgatcctgttcgat
gcggggctgcgcgtggtgtccagcgcccagcacgaattcccgcagcactaccctttttcc
ggctgggtcgagcatgatgcctcggacctttgggtgacggtggctggggtggcgcgtgcg
gcggtggaaaaggccgggctgcatgccggcgacatcgccgccatcggcatcaccaaccag
cgcgagaccacgctgctctgggaccgccggaccggccagccgctgcaccgcgccatcgtc
tggcaggaccgccgcactgccgggctgtgcgaccggctcagggccgaggggcacgagccg
atgatcgccgcccgcaccgggctgctgctcgacccgtatttctcgggctcgaagctgaaa
tggctgctcgacaatatcgacggcgcccgcgcacgcgcccggcgcggcgagctggccttc
ggcaccgtcgacagctggctgatctggaacctgaccggcggccgcgtccatgccaccgac
gccaccaacgccgcccgcaccctgctttacaacatcgccgagaaccgctgggacgccgag
atctgcgcgcttttcgacatccccatgccgcttctgcccgaggtgcgcgactgcgccgcc
gatttcggcatggcgcgggcggacctgttcgggcgcgagatcccgatcctgggcgtcgcc
ggcgaccagcaggcggcgacggtgggccaggcctgcttccagcccggcatgatgaaatcg
acctatggcaccggctgctttgcgctgctgaacaccggggaggagatggtggcgtcgaag
aaccggctgctgagcaccatcgcctatcggctggaggggcggacgacctatgcgctggag
ggctcgatcttcatcgccggcgcggtggtgcaatggctgcgcgacgggctggggctgatc
cgctcggcggccgagacgcagggtctggccgaggcggcggatccggggcaggagctggtc
ctggtgccggccttcaccgggctgggggcgccctattggcggccggattgccggggggcg
gtgttcgggctgacgcggaactcgggtccggcggagctggcgcgggcggcgctggagagc
gtgggtttccagacccgcgacctgtgggaggcgatgcgggcggactggcccggcgcggct
gcgggggtgctgcgggtggatggcggcatggcggcgagcggctggacgatgcagttcctg
gccgacatccttggcgcgccggtggaccggccgcgggtgaccgagacgacggcgcttggc
gcgggctacctggcggggttgcaggcgggcctgtgcccgccgcccggggatttcgcccgc
gattgggccttggagcgccgcttcgagcccgccatggccgagggtgagcgcgagacacgc
tatggccgctggaaacaggccgtgaaggcgacgatgggggtggcatga

DBGET integrated database retrieval system