KEGG   Paracoccus denitrificans: Pden_2680Help
Entry
Pden_2680         CDS       T00440                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
pde  Paracoccus denitrificans
Pathway
pde00010  Glycolysis / Gluconeogenesis
pde00052  Galactose metabolism
pde00500  Starch and sucrose metabolism
pde00520  Amino sugar and nucleotide sugar metabolism
pde00521  Streptomycin biosynthesis
pde01100  Metabolic pathways
pde01110  Biosynthesis of secondary metabolites
pde01120  Microbial metabolism in diverse environments
pde01130  Biosynthesis of antibiotics
pde01200  Carbon metabolism
Module
pde_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pde_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pde00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pden_2680
   00052 Galactose metabolism
    Pden_2680
   00500 Starch and sucrose metabolism
    Pden_2680
   00520 Amino sugar and nucleotide sugar metabolism
    Pden_2680
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Pden_2680
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Pden_2680
Enzymes [BR:pde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Pden_2680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase Pan_kinase ROK
Motif
Other DBs
NCBI-ProteinID: ABL70767
JGI: Pden2680
UniProt: A1B5H3
Position
1:complement(2697697..2698620)
Genome map
AA seq 307 aa AA seqDB search
MAILLADVGGTNARMALARDGALASGTITRFRGDDHASFDEVVTKFLAQQGSPRIDAVCV
AVAGPVWGDEARLTNRDWTFSEARLCALSGAPRARLINDLTALGYATPALDGEAAGFLRA
APEGALSNGQRLVVNAGTGFNVCAVKVLPDGGIACLEAEEGHTRLPLSVADPLAEALGDA
GRAIDSVEELFAGRGLARLHALRMGTPQGRAETVVAAAAEGDGAAEETLALYARLFGLLC
RELALRFMPMDGMFLAGSVARSCTDRFEIFERAFLSDPLMARIPQAVPVGVIRDDMAALH
GCLAAIR
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcctgttggcggatgtgggcggcaccaatgcgcggatggcgctggcgcgggac
ggcgcgcttgcgtccgggaccatcacccggtttcgcggcgacgaccatgccagcttcgac
gaggtggtgacgaagttcctggcccagcagggcagcccgcggatcgacgcggtctgcgtc
gccgtcgccggcccggtctggggtgacgaggcgcggctgaccaatcgcgactggaccttt
tccgaggcgcggctttgcgcgctgtccggcgccccgcgcgcccggctgatcaacgacctg
accgccctgggctatgccacgcccgcgctggacggcgaggcggcgggtttcctgcgcgcg
gcgcccgagggtgcgttgtcgaacggccagcggctggtggtgaatgccggcaccggcttc
aacgtctgcgcggtcaaggtgctgccggacggcgggatcgcctgcctcgaggccgaggaa
ggccatacccgcctgccgctttcggtggccgatccgctggccgaggcactgggcgatgcc
ggccgtgcgattgattcggtcgaggagctgttcgccggccgcggccttgcccggctgcac
gcgctgcgcatgggcacgccgcagggccgggccgaaaccgtggttgccgccgccgccgaa
ggcgatggcgcggccgaggaaacgctggcgctttatgcccggctgttcgggctcctctgc
cgcgaacttgccttgcgattcatgccgatggacgggatgttcctggccggcagtgtcgcc
cgctcctgtaccgatcggttcgaaattttcgagcgcgccttcctctccgacccgctgatg
gcgcggattccgcaggcggtcccggtcggcgtgatccgcgacgacatggccgcgctgcat
ggctgtctggccgcaatccgctga

DBGET integrated database retrieval system