KEGG   Paracoccus denitrificans: Pden_2680Help
Entry
Pden_2680         CDS       T00440                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
pde  Paracoccus denitrificans
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pde00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pden_2680
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pden_2680
   00052 Galactose metabolism
    Pden_2680
   00500 Starch and sucrose metabolism
    Pden_2680
   00520 Amino sugar and nucleotide sugar metabolism
    Pden_2680
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Pden_2680
   00524 Butirosin and neomycin biosynthesis
    Pden_2680
Enzymes [BR:pde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Pden_2680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2697697..2698620)
Genome map
AA seq 307 aa AA seqDB search
MAILLADVGGTNARMALARDGALASGTITRFRGDDHASFDEVVTKFLAQQGSPRIDAVCV
AVAGPVWGDEARLTNRDWTFSEARLCALSGAPRARLINDLTALGYATPALDGEAAGFLRA
APEGALSNGQRLVVNAGTGFNVCAVKVLPDGGIACLEAEEGHTRLPLSVADPLAEALGDA
GRAIDSVEELFAGRGLARLHALRMGTPQGRAETVVAAAAEGDGAAEETLALYARLFGLLC
RELALRFMPMDGMFLAGSVARSCTDRFEIFERAFLSDPLMARIPQAVPVGVIRDDMAALH
GCLAAIR
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcctgttggcggatgtgggcggcaccaatgcgcggatggcgctggcgcgggac
ggcgcgcttgcgtccgggaccatcacccggtttcgcggcgacgaccatgccagcttcgac
gaggtggtgacgaagttcctggcccagcagggcagcccgcggatcgacgcggtctgcgtc
gccgtcgccggcccggtctggggtgacgaggcgcggctgaccaatcgcgactggaccttt
tccgaggcgcggctttgcgcgctgtccggcgccccgcgcgcccggctgatcaacgacctg
accgccctgggctatgccacgcccgcgctggacggcgaggcggcgggtttcctgcgcgcg
gcgcccgagggtgcgttgtcgaacggccagcggctggtggtgaatgccggcaccggcttc
aacgtctgcgcggtcaaggtgctgccggacggcgggatcgcctgcctcgaggccgaggaa
ggccatacccgcctgccgctttcggtggccgatccgctggccgaggcactgggcgatgcc
ggccgtgcgattgattcggtcgaggagctgttcgccggccgcggccttgcccggctgcac
gcgctgcgcatgggcacgccgcagggccgggccgaaaccgtggttgccgccgccgccgaa
ggcgatggcgcggccgaggaaacgctggcgctttatgcccggctgttcgggctcctctgc
cgcgaacttgccttgcgattcatgccgatggacgggatgttcctggccggcagtgtcgcc
cgctcctgtaccgatcggttcgaaattttcgagcgcgccttcctctccgacccgctgatg
gcgcggattccgcaggcggtcccggtcggcgtgatccgcgacgacatggccgcgctgcat
ggctgtctggccgcaatccgctga

DBGET integrated database retrieval system