KEGG   Paracoccus denitrificans: Pden_2726Help
Entry
Pden_2726         CDS       T00440                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
pde  Paracoccus denitrificans
Brite
Enzymes [BR:pde01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Pden_2726
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2745472..2746125
Genome map
AA seq 217 aa AA seqDB search
MTDFAQRRTMMVDTQVRPNEVTSYPVIEAMLNVPREQFVPESRRDVAYVGNNIDLAPGRV
LLEPRTLGKMMDILNLQNGDLVLDVGCGYGYSAAVMARIAEAVVAVEEDAAMAAEAEGRL
AAQDVFNVAVVQGALAEGCPGQAPYDAILIEGAVEQVPEALTEQLREGGRIVALFREGNL
GIVRLGHKLDGRVNWRFAFNAVAPLLPGFARPRGFVL
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatttcgcgcagcgccgcaccatgatggtcgatactcaggttcgtccgaacgaa
gtgaccagctatcccgtgatcgaggcgatgctgaacgtcccgcgcgagcagttcgtcccc
gaatcgcgccgggatgtcgcctatgtcggcaacaatatcgaccttgcccccggccgcgtg
ctgctggagccgcgcacgctgggcaagatgatggatatcctgaacctgcagaacggcgac
ctggttctggatgtcggctgcggctacggctattccgccgcggtcatggcccgcatcgcc
gaggccgtcgtcgccgtcgaggaggatgccgcgatggctgccgaggcggaaggccggctg
gccgcgcaggacgtgttcaacgtcgccgtcgtccagggcgcgctggccgagggctgcccc
ggccaggccccctatgacgccatcctgatcgaaggcgcggtcgagcaggtgcccgaggcg
ctgaccgagcaactgcgcgagggcggccgcatcgtcgccctgttccgcgagggcaatctg
ggcatcgtccgccttggccacaagctggacgggcgcgtgaactggcgctttgccttcaat
gccgtcgccccgctgctgccgggctttgcgcgcccgcggggcttcgtcttgtga

DBGET integrated database retrieval system