KEGG   Paracoccus denitrificans: Pden_2751Help
Entry
Pden_2751         CDS       T00440                                 

Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
pde  Paracoccus denitrificans
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pde00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pden_2751
   00052 Galactose metabolism
    Pden_2751
Enzymes [BR:pde01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Pden_2751
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2770041..2771051
Genome map
AA seq 336 aa AA seqDB search
MMPRKFGMLPDGRPVMQATISGHGLTASIITLGASLQDLRLSGVGHSLVLGFPRLEPYLD
EGRYFGAVVGRHANRIAHGRAVIDGQDLQLDRNQDGRHLLHGGHDGCGTRNWMLADWDES
SVALADYLPAGHMGFPGAMLIRATWSILPGPTLMLTILATSDEATFCNFAQHSYFNLDGA
ETVSDHRLAIPAETYLPVDGDMIPLGDPAPVQGTHLDFRAPVALGERLGGPRIDHNLCVS
SRRRIMPRKVAMLRAGGLMMSLRSTEPGLQVYPGEHLAPGAPGLNGRPYGRHAGIALESQ
LWPDAPNHADYPSALLGPGELYRQSTVMSFCRSPKG
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgatgccccgcaagttcggcatgcttcccgatggccggccagtgatgcaggcgacgatc
tcgggccacgggctgacggcctcgatcatcacgctgggcgcctcgctccaggatctgcgg
ctgtctggggtggggcattcgctggtgctgggctttccccggttggagccctatctggac
gaaggccgctatttcggcgctgtggtcgggcgccatgccaaccgcatcgcgcatggccgc
gccgtgatcgacgggcaggatctgcaactggatcgcaaccaggacgggcgccatctgctg
cacggcggccatgacggctgcggcacccgcaactggatgctggccgattgggacgaaagc
tcggtggcgctggccgattacctgcccgcggggcatatgggctttcccggcgccatgctg
atccgcgccacctggtccatcctgcccggcccgaccctgatgctgacgatcctcgccacc
tcggacgaggccaccttctgcaatttcgcccagcacagctatttcaacctcgacggcgcg
gaaaccgtgtcggaccaccggctggccatcccggccgagacctatctgccggtggacggg
gacatgatcccgctgggcgaccccgccccggtccagggcacgcatctggacttccgcgcc
ccggtcgccctgggcgaacggctgggcgggccgcgcatcgaccacaacctctgcgtctcg
tcccggcgccggatcatgccgcgcaaggtcgcgatgctccgggcgggcgggctgatgatg
agcctgcgctcgaccgagccggggctccaggtctatcccggcgagcatctggcgcccggc
gcgccgggcctaaacggaaggccctatggccgccatgccggcatcgcgctggaatcgcag
ctctggcccgatgcgcccaaccatgccgactatccctcggcgctgctggggccgggcgag
ctctaccgccaaagcacggtgatgagcttttgccgcagcccgaaaggttga

DBGET integrated database retrieval system