KEGG   Paracoccus denitrificans: Pden_2857Help
Entry
Pden_2857         CDS       T00440                                 

Definition
(GenBank) formate dehydrogenase beta subunit
  KO
K00124  formate dehydrogenase iron-sulfur subunit
Organism
pde  Paracoccus denitrificans
Pathway
pde00630  Glyoxylate and dicarboxylate metabolism
pde00680  Methane metabolism
pde01100  Metabolic pathways
pde01120  Microbial metabolism in diverse environments
pde01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pde00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Pden_2857
  Energy metabolism
   00680 Methane metabolism
    Pden_2857
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Complex1_51K NADH_4Fe-4S SLBB
Motif
Other DBs
NCBI-ProteinID: ABL70941
JGI: Pden2857
UniProt: A1B5Z7
Position
2:complement(25194..26735)
Genome map
AA seq 513 aa AA seqDB search
MRVWVPLDAAARALGADEVAEALGREFTITRNGTRGMIWLEPLVEVERDGVRYGYGPVAP
EDAASVAEAIRSGGEHPLALGPVEELPWMKAQTRLTFARVGVIDPLSVSEYEAHGGLVGL
SRAIEIGPERIVEEVTESGLRGRGGAGFPTGIKWKTVAGAKAARKYIVCNADEGDSGSFA
DRMLMEGDPLVLIEGMAIAGIATGAVQGYVYIRSEYPDAIRLMEAAIGKARQAGILGQSV
LGSAHAYDMEVRVGAGAYVCGEETSLLNSLEGKRGVVRAKPPIPALEGFLGRPTVVNNVI
SLASVPWILSHGGAEYAKLGIGRSKGTIPIQIAGNVKYGGLFEAAFGMSLGQIINEVGGG
TASGRPVKAAQVGGPLGSYIPHWNFDVPFGYEELAGKEGLLGHAGITVFDDTADMLKLAR
FAMEFCAVESCGKCTPCRIGSIRGVETIDRIAQGDETGIAILTDLCNTMKWGSLCALGGF
APFPVMSALTHFPDDFSGRREPRAIIRSREAAE
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgagggtctgggttcccctggatgccgccgcaagggccttgggtgccgacgaggtggcc
gaggcgctggggcgcgagttcaccatcacccgcaacggcacgcgcggcatgatctggctg
gagccgttggtcgaggtcgagcgcgacggcgtgcgctacggctatgggccggtggcgccc
gaggacgcggcctcggtcgccgaggcgatccgttcgggcggcgagcatccgctggcgctg
gggccggtcgaggaactgccgtggatgaaggcgcagacccggctgacattcgcccgcgtg
ggcgtgatcgacccgctgtcggtgtccgaatacgaggcgcatggcgggctggtcgggctg
agccgcgccatcgagatcgggccggagcggatcgtcgaggaggtcaccgaatccggtctg
cgcggacggggcggcgccggtttcccgacggggatcaagtggaagaccgtggccggcgcc
aaggccgcgcggaaatacatcgtctgcaatgccgacgagggcgattcgggcagcttcgca
gaccggatgctgatggagggcgatccgctggtcctgatcgagggcatggccatcgccggc
atcgccacgggcgcggtgcagggctatgtctatatccgcagcgaataccccgacgcgatc
cggctgatggaggccgccatcggcaaggcgcggcaggcgggcatcctgggccagtcggtg
ctgggctcggcccatgcctatgacatggaggtgcgggtcggcgccggcgcctatgtctgc
ggcgaggaaacgagcctgctcaacagcctggaaggcaagcgcggcgtggtccgcgccaag
ccgccgatcccggcgctggagggtttcctgggccggccgacggtggtcaacaacgtgatc
tcgctggcttcggtgccttggatcctgagccatggcggggcggaatacgcgaaactgggc
atcgggcgctccaagggcacgatcccgatccagatcgccggcaacgtgaaatacggcggg
ctgttcgaggccgcattcggcatgtcgctgggccagatcatcaacgaggtcggcggcggg
accgcctcggggcggccggtcaaggcggcgcaggtggggggccccctgggctcctacatc
ccgcattggaatttcgacgtgcccttcggctatgaggaactggccgggaaagaggggctg
ctgggccatgccggcatcaccgtcttcgacgacacggccgacatgctgaagctcgcgcgc
tttgccatggagttctgcgccgtagaaagctgcggcaaatgcacgccctgccgcatcggc
tcgatccggggtgtcgagaccatcgaccgcatcgcccagggcgacgaaacggggatcgcg
atcctcaccgacctttgcaacacgatgaaatggggctcgctttgcgcgctggggggcttt
gcgcccttcccggtcatgtcggcgctgacccatttccccgacgatttcagcgggcggcgg
gagccgcgcgccataatcaggagccgggaggccgcagaatga

DBGET integrated database retrieval system