KEGG   Paracoccus denitrificans: Pden_2857Help
Entry
Pden_2857         CDS       T00440                                 

Definition
NADH dehydrogenase (quinone) (EC:1.6.99.5)
Orthology
K00124  
formate dehydrogenase iron-sulfur subunit
Organism
pde  Paracoccus denitrificans
Pathway
Glyoxylate and dicarboxylate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pde01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:pde00630]
Metabolism; Energy metabolism; Methane metabolism [PATH:pde00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(25194..26735)
Genome map
AA seq 513 aa AA seqDB search
MRVWVPLDAAARALGADEVAEALGREFTITRNGTRGMIWLEPLVEVERDGVRYGYGPVAP
EDAASVAEAIRSGGEHPLALGPVEELPWMKAQTRLTFARVGVIDPLSVSEYEAHGGLVGL
SRAIEIGPERIVEEVTESGLRGRGGAGFPTGIKWKTVAGAKAARKYIVCNADEGDSGSFA
DRMLMEGDPLVLIEGMAIAGIATGAVQGYVYIRSEYPDAIRLMEAAIGKARQAGILGQSV
LGSAHAYDMEVRVGAGAYVCGEETSLLNSLEGKRGVVRAKPPIPALEGFLGRPTVVNNVI
SLASVPWILSHGGAEYAKLGIGRSKGTIPIQIAGNVKYGGLFEAAFGMSLGQIINEVGGG
TASGRPVKAAQVGGPLGSYIPHWNFDVPFGYEELAGKEGLLGHAGITVFDDTADMLKLAR
FAMEFCAVESCGKCTPCRIGSIRGVETIDRIAQGDETGIAILTDLCNTMKWGSLCALGGF
APFPVMSALTHFPDDFSGRREPRAIIRSREAAE
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgagggtctgggttcccctggatgccgccgcaagggccttgggtgccgacgaggtggcc
gaggcgctggggcgcgagttcaccatcacccgcaacggcacgcgcggcatgatctggctg
gagccgttggtcgaggtcgagcgcgacggcgtgcgctacggctatgggccggtggcgccc
gaggacgcggcctcggtcgccgaggcgatccgttcgggcggcgagcatccgctggcgctg
gggccggtcgaggaactgccgtggatgaaggcgcagacccggctgacattcgcccgcgtg
ggcgtgatcgacccgctgtcggtgtccgaatacgaggcgcatggcgggctggtcgggctg
agccgcgccatcgagatcgggccggagcggatcgtcgaggaggtcaccgaatccggtctg
cgcggacggggcggcgccggtttcccgacggggatcaagtggaagaccgtggccggcgcc
aaggccgcgcggaaatacatcgtctgcaatgccgacgagggcgattcgggcagcttcgca
gaccggatgctgatggagggcgatccgctggtcctgatcgagggcatggccatcgccggc
atcgccacgggcgcggtgcagggctatgtctatatccgcagcgaataccccgacgcgatc
cggctgatggaggccgccatcggcaaggcgcggcaggcgggcatcctgggccagtcggtg
ctgggctcggcccatgcctatgacatggaggtgcgggtcggcgccggcgcctatgtctgc
ggcgaggaaacgagcctgctcaacagcctggaaggcaagcgcggcgtggtccgcgccaag
ccgccgatcccggcgctggagggtttcctgggccggccgacggtggtcaacaacgtgatc
tcgctggcttcggtgccttggatcctgagccatggcggggcggaatacgcgaaactgggc
atcgggcgctccaagggcacgatcccgatccagatcgccggcaacgtgaaatacggcggg
ctgttcgaggccgcattcggcatgtcgctgggccagatcatcaacgaggtcggcggcggg
accgcctcggggcggccggtcaaggcggcgcaggtggggggccccctgggctcctacatc
ccgcattggaatttcgacgtgcccttcggctatgaggaactggccgggaaagaggggctg
ctgggccatgccggcatcaccgtcttcgacgacacggccgacatgctgaagctcgcgcgc
tttgccatggagttctgcgccgtagaaagctgcggcaaatgcacgccctgccgcatcggc
tcgatccggggtgtcgagaccatcgaccgcatcgcccagggcgacgaaacggggatcgcg
atcctcaccgacctttgcaacacgatgaaatggggctcgctttgcgcgctggggggcttt
gcgcccttcccggtcatgtcggcgctgacccatttccccgacgatttcagcgggcggcgg
gagccgcgcgccataatcaggagccgggaggccgcagaatga

DBGET integrated database retrieval system