KEGG   Paracoccus denitrificans: Pden_2871Help
Entry
Pden_2871         CDS       T00440                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
pde  Paracoccus denitrificans
Pathway
pde00071  Fatty acid degradation
pde00280  Valine, leucine and isoleucine degradation
pde00281  Geraniol degradation
pde00310  Lysine degradation
pde00362  Benzoate degradation
pde00380  Tryptophan metabolism
pde00410  beta-Alanine metabolism
pde00640  Propanoate metabolism
pde00650  Butanoate metabolism
pde00903  Limonene and pinene degradation
pde00930  Caprolactam degradation
pde01040  Biosynthesis of unsaturated fatty acids
pde01100  Metabolic pathways
pde01110  Biosynthesis of secondary metabolites
pde01120  Microbial metabolism in diverse environments
pde01130  Biosynthesis of antibiotics
pde01200  Carbon metabolism
pde01212  Fatty acid metabolism
Module
pde_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pde00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Pden_2871
   00650 Butanoate metabolism
    Pden_2871
  Lipid metabolism
   00071 Fatty acid degradation
    Pden_2871
   01040 Biosynthesis of unsaturated fatty acids
    Pden_2871
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Pden_2871
   00310 Lysine degradation
    Pden_2871
   00380 Tryptophan metabolism
    Pden_2871
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Pden_2871
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Pden_2871
   00281 Geraniol degradation
    Pden_2871
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Pden_2871
   00930 Caprolactam degradation
    Pden_2871
Enzymes [BR:pde01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Pden_2871
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Pden_2871
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Pden_2871
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N 3HCDH ECH_1 ECH_2 NAD_binding_2 DAO 2-Hacid_dh_C NAD_Gly3P_dh_N NAD_binding_8 F420_oxidored FAD_binding_3 UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: ABL70955
JGI: Pden2871
UniProt: A1B611
Position
2:37026..39209
Genome map
AA seq 727 aa AA seqDB search
MTDFTMQKDADGVAIVTWDVPGKSMNVLSLDGAAELNALIDDALADEAVKGIVITSGKKD
FAAGMDLNVIAGMRQGGAQAVFDGVMTLHHLLRKIELAGMDPKTKKGGKPIAAALPGTAL
GIGLELPLATHRIFAAENPKAKIGLPEIMVGIFPGAGGTTRLVRKLGAMGAAPFLLEGKL
SDPARAKSAGLIDEVVADPVAAAREWVLKAADADLVKPWDAKGYKMPGGEPYHPAGFMTF
VGASAMVHGKTLGVYPAAKALLSAVYEGAMVPFDTALKIEARWFTHVLMNPSSTAMIRSL
FINKEALEKGANRPEAPDQSVRKVGILGAGMMGAGIAYVSAMAGIKVVLIDSTQEAAERG
KSYSTGLLDKAISRRKSTEEKKAEVLSRITATTDYAALAGCDLIVEAVFEDPKVKAEVTK
RAEAVIPQDAIFATNTSTLPISELAKASARPDQFIGIHFFSPVDKMLLVEIIKGRETGPR
AVAKALDFVRQIRKTPIVVNDARFFYANRCIIPYINEGIRMVAEGVSPTLIENAAKMMGM
PLGPLQLVDETSIDLGVKIAKATKAAMGDAYPDGAVDAVIFKLADQGRLGRKTKAGFYDY
DDAGKRQGFWSGLASEWPEADTQPDLTEIQHRLMFAQSLEAVRALEEGVLEDIREGDVGA
ILGWGFAPWSGGPFGWLDMLGAPRAAGIADSLAEKFGPRFAAPQLLRDMAAKGESFYGRF
GAGKQAA
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatttcaccatgcagaaagacgccgacggcgtcgcgatcgtcacctgggacgtg
ccgggcaagtcgatgaacgtgctgtcgctggacggcgccgccgagttgaacgcactgatc
gacgacgccctggccgacgaggccgtgaagggcatcgtcatcaccagcggcaagaaggat
ttcgccgccggcatggacctgaacgtcatcgccggcatgaggcagggcggcgcgcaggcg
gtcttcgacggcgtgatgacgctgcatcatctgctgcgcaagatcgagctggccgggatg
gaccccaagaccaagaagggcggcaagcccatcgcggccgccctgcccggcaccgcactg
ggaatcgggctggaactgccgctggccacgcatcgcatctttgccgccgagaaccccaag
gccaagatcggcctgcccgagatcatggtcggcatctttcccggcgccggcggcaccacc
cgcctggtgcgcaagctgggcgccatgggcgccgcccccttcctgctggagggcaagctc
agcgacccggccagggccaagagcgccggcctgatcgacgaggtggtggccgatccggtc
gccgcggcccgcgaatgggtgttgaaggccgccgatgccgacctggtcaagccttgggac
gccaagggctacaagatgccgggcggcgagccctatcacccggccggcttcatgaccttc
gtcggcgccagcgccatggtgcatggcaagacgctgggcgtctatccggcggcgaaggcg
ctgctgagcgccgtctatgaaggtgccatggtgcccttcgacacggcgctgaagatcgaa
gcgcgctggttcacccatgtgctgatgaacccctcctcgaccgcgatgatccgcagcctc
ttcatcaacaaggaggcgctggagaagggcgcgaaccgtcccgaggctcccgatcagagc
gtgaggaaggtcggcatcctcggcgccggcatgatgggcgccggcatcgcgtatgtctcg
gccatggccgggatcaaggtggtgctgatcgattcgacgcaagaagcggccgagcgcggc
aagtcctactccaccggcctgctggacaaggcgatcagtcgccgcaaatccaccgaggag
aagaaggccgaggtgctttcccgcatcaccgcgacgaccgattacgccgcactggccggc
tgcgacctgatcgtggaagccgtgttcgaggatccgaaggtcaaggccgaggtcacgaaa
cgggccgaggcggtgatcccgcaggacgcgatcttcgccaccaacacctcgaccctgccg
atcagcgaactggccaaggccagcgcccgccccgaccagttcatcggcatccacttcttc
agccccgtggacaagatgctgttggtcgaaatcatcaagggccgcgagaccggcccgcgc
gcggtggccaaggcgctcgacttcgtgcgccagatccgcaagacgcccatcgtggtcaac
gacgcacgcttcttctacgccaaccgctgcatcatcccctatatcaacgaaggcatccgc
atggtggccgaaggggtcagccccacgctgatcgaaaacgccgccaagatgatgggcatg
ccgctgggaccgctgcaactggtggacgagacctcgatcgacctcggcgtcaagatcgcc
aaggccaccaaggcggcgatgggcgacgcctacccggacggcgcagtggatgcggtgatc
ttcaagcttgccgaccagggccggctcggccgcaagaccaaggccggcttctacgactat
gacgatgccggcaagcgccagggcttctggtccggcctcgcatccgaatggcccgaggcc
gacacccagcccgacctgaccgagatccagcaccggctgatgttcgcgcaatcgctggaa
gcggtccgggcgctggaagaaggcgtgctcgaggacatccgcgaaggcgatgtcggcgcc
atcctcggctggggcttcgcgccctggtccggcggccccttcggctggctcgacatgctg
ggcgccccccgcgccgccggaatcgccgacagcctggcggaaaaattcggcccccgcttc
gccgcgccgcaactcctcagggacatggctgcgaaaggcgaaagcttctacggccgcttc
ggcgccggcaaacaggccgcctga

DBGET integrated database retrieval system