KEGG   Paracoccus denitrificans: Pden_2909Help
Entry
Pden_2909         CDS       T00440                                 

Definition
AMP-dependent synthetase/ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pde  Paracoccus denitrificans
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pde00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pden_2909
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pden_2909
   00620 Pyruvate metabolism
    Pden_2909
   00640 Propanoate metabolism
    Pden_2909
  Energy metabolism
   00680 Methane metabolism
    Pden_2909
Enzymes [BR:pde01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Pden_2909
Lipid biosynthesis proteins [BR:pde01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Pden_2909
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(71302..72993)
Genome map
AA seq 563 aa AA seqDB search
MRESLRRRDMSATTLSRSRPGYEQAVAQFRIEDAIAGLRGDLETGLNACVECCDRHCGAD
RVALRCLSADEALVEYTFEDLRALSARAANLMRDKGIRPGDVVAGLLPRTVELVATVLGA
WRLGAVYQPLFTAFGPKAIEHRLKTSGAKLVVTNAAQRPKLDEVEDCPLVATLRGDGPLA
PGDVDFREALAMASDQFEPVMRRGEDLFMMMSTSGTTGLPKGVPVPLRALLAFGAYMRDA
IDLRETDVFWNIADPGWAYGLYYALTGPLLLGQPTILYEGGFTAETTYRIIERMGVTSLA
GSPTAYRLLIAAGPEAAGAVKGRLRVVSSAGEPLNPEIIRWFGEHLAVPIHDHYGQTEMG
MCVNNHHGLEHPVRPGSAGLAMPGYRIVVLDDDGNELGPNQPGVLAIDMKRSPLMWFSGY
LNQATPALAGGYYRTGDSVEFEPDGSISFIGRSDDVITSSGYRIGPFDVESALIEHPAVV
EAAVVGVPDPERTEIVKAFVVLAKGVEGTEALREELAQHVKKRLSAHAYPRMIDFVADLP
KTPSGKIQRFVLRKAEVEKLARE
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgcgggagagtttgaggaggagagacatgtctgcgacgaccctgtcccggtcgcggccc
ggctatgagcaggccgtggcgcaattccgcatcgaggacgccatcgccgggctgcgcggc
gacctggagaccgggctgaacgcctgcgtcgaatgctgcgaccgccattgcggcgcggac
cgggtggcgctgcgctgcctgtcggcggacgaggcgctggtggaatacacattcgaggat
ctgcgcgcgctgtcggcgcgggcggcgaacctgatgcgcgacaagggcatccggccgggc
gacgtggtggcggggctgttgccgcgcacggtcgagctggtcgcgacggtgctgggcgcc
tggcggctgggcgcggtctatcagccgctgttcaccgcctttggtcccaaggccatcgag
caccggctgaagaccagcggcgccaagctggtggtgacgaatgccgcgcagcggcccaag
ctggacgaggtcgaggactgcccgctggtcgccaccctgcgcggcgacgggccgctggcg
ccgggcgatgtcgatttccgcgaggcgctggccatggcctcggaccagttcgagccggtg
atgcggcgcggcgaggatctgttcatgatgatgtccacctcgggcaccacagggctgccc
aagggggtgccggtgccgttgcgggcgctcttggcattcggcgcctatatgcgcgacgcc
atcgacctgcgcgagacggacgtgttctggaacatcgccgatccgggctgggcttacggg
ctttactatgcgctgaccgggcccctgctgctgggccagccgacgatcctctacgaaggc
ggctttaccgccgagacgacctatcgcatcatcgagcgcatgggggtgacgagccttgcc
ggctcgcctaccgcataccggctgctgatcgcggcggggccggaggcggccggggcggtc
aaggggcggctgcgggtggtcagttccgccggcgagcccctgaaccccgagatcatccgc
tggttcggcgagcatctggcggtgccgatccacgaccattacggccagaccgagatgggc
atgtgcgtgaacaaccatcacgggctggagcatccggtgcgtccgggctcggccgggctg
gcgatgccgggctatcgcatcgtggtgctggacgatgacggcaacgaactgggaccgaac
cagccgggcgtgctggccatcgacatgaagcgttcgccgctgatgtggttttccggctat
ctgaaccaggcgacgccggcgctggcggggggctattaccgcaccggcgacagcgtggag
ttcgagccggacgggtcgatcagctttatcgggcggtcggacgacgtgatcacgtcctcg
ggctatcgcatcgggcccttcgacgtggaaagcgcgctgatcgagcatcctgcggtggtc
gaggcggcggtggtcggcgtgccggatcccgagcggaccgagatcgtgaaagccttcgtc
gtgctggccaagggggtcgaggggaccgaggcgctgcgcgaggaactggcgcagcatgtc
aagaaacgcttgtcggcccatgcctatccccggatgatcgatttcgtcgccgacctgccc
aagacgccgagcggcaagatccagcgctttgtcctgcgcaaggcggaagtcgaaaaactg
gcccgggagtaa

DBGET integrated database retrieval system