KEGG   Paracoccus denitrificans: Pden_3316Help
Entry
Pden_3316         CDS       T00440                                 

Definition
hypothetical protein
Organism
pde  Paracoccus denitrificans
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:478185..478664
Genome map
AA seq 159 aa AA seqDB search
MKVLVPLVLALGIATPAGALDAIGEIGANLDGEELNWQVMRQDDGSAMVQITDIGPLTMI
ELHALGDGSISIGLIFHGKPSGDTPPAGLTIDMRPDRGAMAGAVWESEEEPPQMSIDLLD
LEDEGRIQASFAATLCRRDAPDDCRDVEGRIDTSLGAGP
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtgcttgtcccgcttgtcctggccctcggaatcgcaacccccgctggtgcattg
gacgccatcggcgagatcggggcaaacttggacggtgaagaactgaactggcaggtgatg
cgtcaggatgatggctcggcgatggtgcagatcaccgatatcggcccgctgaccatgatc
gaactgcatgcacttggtgacggcagcatttctatcggcctgatctttcacggcaagcct
tccggagatacgccgcccgccggtctgaccatcgacatgcggcccgatcgcggggcgatg
gcgggcgcggtctgggaaagcgaggaagagccgccgcagatgtcgatcgacctgctggat
cttgaggatgaaggccgcatccaggccagctttgcggcaaccctatgccgccgggatgcc
ccggacgactgtcgcgacgtcgaggggcggatcgacacgtcgttgggtgcaggcccatga

DBGET integrated database retrieval system