KEGG   Paracoccus denitrificans: Pden_3647Help
Entry
Pden_3647         CDS       T00440                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
pde  Paracoccus denitrificans
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pde00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Pden_3647 (recR)
DNA repair and recombination proteins [BR:pde03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Pden_3647 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(796871..797470)
Genome map
AA seq 199 aa AA seqDB search
MAAAGDEIETLIATMARLPGLGPRSARRIVLHLIRRRTGQMAQLAGLMANVAEHARECLV
CGNVTGSDICPICEDPDRATGEICVVTDVADLWALERGRAFHGRYHVLGGSLSALDEVGP
EDLRIPQLIARIAEEGITEVILALSATVEGQTTAHYIAEALAPTGVAVTGLAQGVPIGGE
LDYLDDGTITAALRARRKL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggccgctgccggcgacgagatcgagacgctgatcgccaccatggcgcgcctgccgggg
ctcggcccccgctcggcgcggcgcatcgtgctgcacctgatccgccgccgcaccggacag
atggcgcaattggcggggctgatggccaatgtggcggagcatgcccgcgaatgcctggtc
tgcggcaacgtcaccggctccgacatctgcccgatctgcgaggacccggatcgcgccacc
ggcgagatctgcgtcgtgaccgacgtggccgacctctgggcgctggaacgcggccgcgcc
tttcacggccgctaccatgtgctcggcggcagcctctcggcactggacgaggtcggaccc
gaggacctgcgcatcccgcaactcatcgcccgcatcgccgaggaaggcatcaccgaggtc
atcctcgccctctcggccacggtcgagggccagaccacggcgcattacatcgccgaggcg
ctggcgccgactggcgtcgccgtcaccggcctggcgcaaggcgtgccgatcggcggcgaa
ctcgactatctggacgacggcaccatcaccgccgcgctgcgcgcccgccgcaagctctga

DBGET integrated database retrieval system