KEGG   Paracoccus denitrificans: Pden_3791Help
Entry
Pden_3791         CDS       T00440                                 

Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pde  Paracoccus denitrificans
Pathway
pde00260  Glycine, serine and threonine metabolism
pde00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pde01100  Metabolic pathways
pde01110  Biosynthesis of secondary metabolites
pde01130  Biosynthesis of antibiotics
pde01230  Biosynthesis of amino acids
Module
pde_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pde00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pden_3791
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Pden_3791
Enzymes [BR:pde01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Pden_3791
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABL71857
JGI: Pden3791
UniProt: A1B8L3
Position
2:925618..926850
Genome map
AA seq 410 aa AA seqDB search
MAEDLINSFMTGPDEQGRFGIFGGRFVSETLMPLILDLEAEYERAKDDASFWAEMDDLWK
HYVGRPSPLYFAPRLTEELGGAKIYLKREELNHTGSHKINNVLGQILLARRMGKTRIIAE
TGAGQHGVATATVCARFGLKCIVYMGAHDVERQAPNVFRMRLLGAEVVPVTSGRGTLKDA
MNDALRDWVTNVRDTFYCIGTVAGPHPYPAMVRDFQCIIGRETRRQLAEQEGEGRLPDSV
VAAIGGGSNAMGLFHPFLDEPSVRIIGVEAGGKGVDERMQHCASLTGGRPGVLHGNRTYL
LQDGEGQILEGHSISAGLDYPGIGPEHAWLKEQGRAEYVSVTDDEALAAFQTLCRLEGII
PALEPSHALAHVVKIAPDLPRDHIMVVNLSGRGDKDIFTVAKHLGVDIRT
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggccgaagacctcatcaacagcttcatgaccggcccggacgagcagggccgcttcggc
atcttcggcggccgcttcgtcagcgagacgctgatgccgctgatcctcgacctcgaggcc
gaatacgagcgcgccaaggacgacgcgtccttctgggccgagatggacgatctgtggaaa
cattacgtcggccggcccagcccgctctatttcgccccgcgcctgaccgaggaactgggc
ggtgccaagatctatctcaagcgcgaagagctgaaccataccggcagccacaagatcaac
aacgtgctgggccagatcctgctggcgcgccgcatgggcaagacccggatcatcgccgaa
accggcgccggccagcatggcgtggcgaccgcgacggtctgcgcccgcttcgggctgaaa
tgcatcgtctacatgggcgcgcatgacgtcgagcgccaggcgccgaacgtcttccgcatg
cggctgctgggcgccgaggtggtgccggtcacctcgggccgcggcacgctcaaggatgcg
atgaacgacgcgctgcgcgactgggtgaccaatgtgcgcgacaccttctattgcatcggc
accgtcgccggcccgcatccctatccggccatggtgcgcgatttccaatgcatcatcggt
cgcgagacccgccggcaactggccgagcaggaaggcgaggggcggctgcccgacagcgtg
gtcgcggccatcggcggcggctcgaacgccatggggctgttccatcccttcctcgacgag
ccctcggtgcgcatcatcggcgtcgaggccggcggcaagggcgtcgacgagcgcatgcag
cattgcgccagcctgaccggcggccgccccggcgtgctgcacggcaatcgcacctatctg
ctccaggacggcgagggccagatcctcgaaggccattcgatcagcgccggtctggactat
cccggtatcggacccgagcatgcctggctcaaggaacagggccgcgccgaatatgtcagc
gtgaccgatgacgaggcgctggcggccttccagaccctttgccggctcgaaggcatcatc
ccggcgctggagcccagccacgcgctggcccatgtcgtcaagatcgcgccggacctgccg
cgcgaccatatcatggtggtgaacctgtcgggccggggcgacaaggacatcttcaccgtc
gccaagcatctcggcgtcgatatccgcacctga

DBGET integrated database retrieval system