KEGG   Paracoccus denitrificans: Pden_3791Help
Entry
Pden_3791         CDS       T00440                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pde  Paracoccus denitrificans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pde00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Pden_3791
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pden_3791
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Pden_3791
Enzymes [BR:pde01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Pden_3791
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2:925618..926850
Genome map
AA seq 410 aa AA seqDB search
MAEDLINSFMTGPDEQGRFGIFGGRFVSETLMPLILDLEAEYERAKDDASFWAEMDDLWK
HYVGRPSPLYFAPRLTEELGGAKIYLKREELNHTGSHKINNVLGQILLARRMGKTRIIAE
TGAGQHGVATATVCARFGLKCIVYMGAHDVERQAPNVFRMRLLGAEVVPVTSGRGTLKDA
MNDALRDWVTNVRDTFYCIGTVAGPHPYPAMVRDFQCIIGRETRRQLAEQEGEGRLPDSV
VAAIGGGSNAMGLFHPFLDEPSVRIIGVEAGGKGVDERMQHCASLTGGRPGVLHGNRTYL
LQDGEGQILEGHSISAGLDYPGIGPEHAWLKEQGRAEYVSVTDDEALAAFQTLCRLEGII
PALEPSHALAHVVKIAPDLPRDHIMVVNLSGRGDKDIFTVAKHLGVDIRT
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggccgaagacctcatcaacagcttcatgaccggcccggacgagcagggccgcttcggc
atcttcggcggccgcttcgtcagcgagacgctgatgccgctgatcctcgacctcgaggcc
gaatacgagcgcgccaaggacgacgcgtccttctgggccgagatggacgatctgtggaaa
cattacgtcggccggcccagcccgctctatttcgccccgcgcctgaccgaggaactgggc
ggtgccaagatctatctcaagcgcgaagagctgaaccataccggcagccacaagatcaac
aacgtgctgggccagatcctgctggcgcgccgcatgggcaagacccggatcatcgccgaa
accggcgccggccagcatggcgtggcgaccgcgacggtctgcgcccgcttcgggctgaaa
tgcatcgtctacatgggcgcgcatgacgtcgagcgccaggcgccgaacgtcttccgcatg
cggctgctgggcgccgaggtggtgccggtcacctcgggccgcggcacgctcaaggatgcg
atgaacgacgcgctgcgcgactgggtgaccaatgtgcgcgacaccttctattgcatcggc
accgtcgccggcccgcatccctatccggccatggtgcgcgatttccaatgcatcatcggt
cgcgagacccgccggcaactggccgagcaggaaggcgaggggcggctgcccgacagcgtg
gtcgcggccatcggcggcggctcgaacgccatggggctgttccatcccttcctcgacgag
ccctcggtgcgcatcatcggcgtcgaggccggcggcaagggcgtcgacgagcgcatgcag
cattgcgccagcctgaccggcggccgccccggcgtgctgcacggcaatcgcacctatctg
ctccaggacggcgagggccagatcctcgaaggccattcgatcagcgccggtctggactat
cccggtatcggacccgagcatgcctggctcaaggaacagggccgcgccgaatatgtcagc
gtgaccgatgacgaggcgctggcggccttccagaccctttgccggctcgaaggcatcatc
ccggcgctggagcccagccacgcgctggcccatgtcgtcaagatcgcgccggacctgccg
cgcgaccatatcatggtggtgaacctgtcgggccggggcgacaaggacatcttcaccgtc
gccaagcatctcggcgtcgatatccgcacctga

DBGET integrated database retrieval system