KEGG   Paracoccus denitrificans: Pden_3890Help
Entry
Pden_3890         CDS       T00440                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pde  Paracoccus denitrificans
Pathway
pde00010  Glycolysis / Gluconeogenesis
pde00020  Citrate cycle (TCA cycle)
pde00620  Pyruvate metabolism
pde01100  Metabolic pathways
pde01110  Biosynthesis of secondary metabolites
pde01120  Microbial metabolism in diverse environments
pde01130  Biosynthesis of antibiotics
pde01200  Carbon metabolism
Module
pde_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pde00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pden_3890
   00020 Citrate cycle (TCA cycle)
    Pden_3890
   00620 Pyruvate metabolism
    Pden_3890
Enzymes [BR:pde01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Pden_3890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 QRPTase_N RnfC_N
Motif
Other DBs
NCBI-ProteinID: ABL71956
JGI: Pden3890
UniProt: A1B8W2
Position
2:complement(1023906..1025210)
Genome map
AA seq 434 aa AA seqDB search
MPTEILMPALSPTMEEGTLAKWLVKEGDEVKSGDILAEIETDKATMEFEAVDEGKLGKIL
IAEGTAGVKVNTPIAVLLEEGESADDIGAAPAPKPEAKAEADAPKAEAAAAPAAAAAPAP
AAPKSADGGRIFASPLARRIAAEKGIDLASVAGSGPHGRIVKADVEGAKPGAAKPAAEAP
KAAPAPAAAAPAGPSAETILKMYADRETEEVALDGMRRTIAARLSEAKQTIPHFYLRRSA
KLDELMKFRAMLNKQLESRGVKLSVNDFIIKACALALQEVPDANAVWAGDRILKLKPSDV
AVAVAIEGGLFTPVLKDAQQKTLSALSAEMKDLANRAKTKKLAPHEYQGGSFAISNLGMF
GIENFDAVINPPHGAILAVGAGIQTPVVENGEVVVRNVMSMTLSVDHRVIDGALGAQLLE
AIVKHLENPMGMLA
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgccgacagaaatcctgatgcccgcgctttctccgaccatggaagagggcacgctggcc
aaatggctggtgaaagagggcgacgaggtcaaatccggcgacatcctggccgagatcgag
accgacaaggccacgatggaattcgaggccgtggacgaaggcaagctgggcaagatcctg
atcgccgagggcacggcgggggtcaaggtcaacacccccatcgccgtgctgctggaagaa
ggcgaatccgccgacgacatcggcgcggcgccggcgcccaaacccgaagccaaggccgag
gccgatgccccgaaggccgaggccgccgcggcaccggcggcagccgcagcccctgccccg
gccgcgccgaaatcggccgatggcgggcgcatcttcgcctcgccgctggcccggcgcatc
gcggccgaaaagggcatcgacctcgcctcggtcgccggctcgggtccgcatggccgcatc
gtcaaggcggatgtcgagggcgccaagcccggcgcggccaagcccgccgccgaggctccg
aaagccgcccctgccccggcggccgccgcacctgccggcccctccgcggaaaccatcctc
aagatgtatgccgaccgcgagaccgaagaagtggcgctggacggcatgcgccgcaccatc
gccgcacgcctgtcggaagccaagcagaccatcccgcatttctacctgcgccggtccgca
aagctagacgagttgatgaagttccgcgccatgctgaacaagcagctggaatcgcgcggc
gtgaagctgtcggtcaacgacttcatcatcaaggcctgcgcgctggcactgcaagaggtg
ccggatgccaacgcggtctgggccggcgaccgcatcctcaagcttaagccttcggacgtg
gccgtcgccgtggcgatcgagggcggactcttcaccccggtgctcaaggacgcgcagcaa
aagaccctgtcggcgctgtccgccgagatgaaggacctggccaaccgcgccaagaccaag
aagctagcgccgcatgaataccagggcggcagcttcgctatctcgaacctcggcatgttc
gggatcgagaacttcgacgcggtgatcaacccgccgcatggcgcgatccttgccgtcggc
gccggcatccagaccccggtggtcgagaatggcgaggtggtggtccgcaacgtcatgtcg
atgaccctgtcggtcgaccaccgcgtgatcgacggcgcgcttggcgcccagttgctggaa
gccatcgtcaagcatctggaaaaccccatgggcatgctggcctga

DBGET integrated database retrieval system