KEGG   Paracoccus denitrificans: Pden_3897Help
Entry
Pden_3897         CDS       T00440                                 

Definition
deoxyribose-phosphate aldolase (EC:4.1.2.4)
Orthology
K01619  
deoxyribose-phosphate aldolase [EC:4.1.2.4]
Organism
pde  Paracoccus denitrificans
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pde00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Pden_3897
Enzymes [BR:pde01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.4  deoxyribose-phosphate aldolase
     Pden_3897
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:1030550..1031494
Genome map
AA seq 314 aa AA seqDB search
MERKNPGTDFRLDWFENIQVNTPAAERRATSLAARRSLKKEWQAAWLLNAVRCIDLTTLS
GDDTPDRVARLCAKARQPVDAGQLAALGVEHLTTGAVCVYPTMVAAAKRALRGTAIPVAS
VATGFPAGLMPLDLRLAEIRYALDQGADEIDIVISRALVLRGEWAALYDEICEMREACGS
ARMKAILATGELKTLTNVARASHVAMQAGADFIKTSTGKEPVNATLPVSLVMLRAIRDYR
DQTGFAVGFKPAGGLRTAKDALNWQVLMAEELGRDWLRPDLFRIGASSLLADIERQISHH
VTGRYAGAHRLAAG
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggagcgcaagaaccccggcaccgatttccgcctcgactggttcgagaacatccaggtc
aacaccccggccgccgagcgccgcgccacgagcctggccgcgcgacgcagtctcaagaag
gaatggcaggcggcctggcttctgaacgcggtgcgctgcatcgacctgaccacgctttcg
ggcgacgacacgcccgaccgcgtggcgcggctttgcgccaaggcgcgccagcccgtcgat
gccggccagcttgccgcgctgggggtcgagcatctgaccaccggcgcggtctgcgtctat
ccgaccatggtcgcggcggcaaagcgggcgctgcggggcaccgcgatccccgtcgcctcg
gtcgcgaccggctttcccgccgggctgatgccgctggacctgcggctggccgagatccgc
tatgcgctggaccagggcgcggacgaaatcgacatcgtgatttcccgtgcgctggtgctg
cgcggcgaatgggcggcgctttacgacgagatatgcgagatgcgcgaggcttgcggctcg
gcgcggatgaaggcgatcctggcgacgggcgagctcaagaccctgaccaatgtcgccagg
gccagccatgtcgccatgcaggccggcgccgatttcatcaagacctcgaccggaaaagag
ccggtgaacgccacgctgccggtgtcgctggtcatgttgcgcgccatccgcgactatcgc
gaccagaccggctttgccgtgggcttcaagccggctggcgggttgcggacggccaaggat
gcgctgaactggcaggtgctgatggccgaggagctgggccgcgactggctgcggcccgat
ctgttccgcatcggcgccagttcgctgttggccgatatcgagcggcagatttcccatcac
gtcaccgggcgctatgccggcgcccatcgtctggccgcggggtga

DBGET integrated database retrieval system