KEGG   Paracoccus denitrificans: Pden_4051Help
Entry
Pden_4051         CDS       T00440                                 

Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
pde  Paracoccus denitrificans
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:pde00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pden_4051
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Pden_4051
   00630 Glyoxylate and dicarboxylate metabolism
    Pden_4051
Enzymes [BR:pde01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Pden_4051
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(1201502..1203649)
Genome map
AA seq 715 aa AA seqDB search
MGRVEKAGLRVDETLAAFINERALPGSGVEPRRFWEGLSMLIHEFGPRNRALLDRRDELQ
SAIDGWHIAHRAEPKDTGAYRDFLAEIGYLVPEGEDFQIETPETDPEFSSIAGPQLVVPI
TNARYALNAANARWGSLYDALYGTDALGDLPQGRGYDAARGARVIAWGRDFLDTAAPLAE
GSWAAIEGLSVKDGALVPALREGAKFAGHRGEAEKPTDIFLKNHGLLIRIVIDPSTPVGA
QDKAGISDIVIESALSAIMDCEDSVACVDGEDKALAYANWLGLMDGTLAEEVEKGGKTFT
RRLNPDVTFTAPDGSEVTAKGRALMLVRNVGHLMTTPAVLDRDGGEVYEGLLDAMVTALC
AKRDLDREGPKNSVTQSIYVVKPKMHGPEEVAFACEIFDFVEDVLGLPRHTVKLGIMDEE
RRTSANLKECIRAAKHRVAFINTGFLDRTGDEIHTSMEAGAMLAKGEMKAQPWISAYEDR
NVDIGLACGLAGKAQIGKGMWAIPDRMAEMLEQKIAHPMAGANTAWVPSPTAATLHATHY
HKVDVFARQAQIAALRRPSRLDDLLTIPLAGGRNYSEAEITRELENNCQGILGYVVRWID
QGVGCSKVPDINDVGLMEDRATLRISAQSLANWLHHGIVSDGQVMDAFRKMAVVVDRQNA
DDPAYAPMAPGYDGVAFQAACDLVFLGRMQPSGYTEPVLHARRLQAKAEQAQKAA
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgcgtggaaaaggcaggattgcgggtggacgagacgcttgccgccttcatcaac
gagcgtgcgctgcccggcagcggggtcgagccgcgccggttctgggaggggctttcgatg
ctgatccacgagttcggcccccgcaaccgcgcgctgctggaccggcgcgacgagctgcaa
tcggccatcgacggctggcacatcgcccatcgcgccgagccgaaggataccggcgcatac
cgcgatttcctggccgagatcggctatctggttcccgagggcgaggatttccagatcgag
acccccgagaccgacccggaattctccagcatcgccgggccgcagctggtggtgccgatc
accaatgcgcgctatgcgctgaacgcggccaatgcccgctggggcagcctttacgacgcg
ctttacggcaccgatgccctgggcgacctgccgcaaggcaggggctatgacgccgcgcgc
ggcgcccgcgtcattgcctggggccgtgatttcctcgatacggccgcgccgctggccgag
ggttcctgggccgcgattgaggggctgtcggtcaaggatggcgcgctggtcccggcgctg
cgcgaaggggccaagttcgccggccatcgcggcgaggccgaaaagccgaccgacatcttc
ctgaagaaccacgggctgctgatccgcatcgtcatcgatccgtccacgccggtcggcgcg
caggacaaggcgggcatctcggacatcgtgatcgaatcggcgctgtcggcgatcatggat
tgcgaggattccgtcgcctgcgtcgatggcgaggacaaggcgctggcctatgccaactgg
ctgggcctgatggatggcaccctggccgaagaggtcgagaagggcggcaagacctttacc
cgccgcctcaatcccgacgtgaccttcactgcgcccgacggctcggaagtcaccgccaag
ggccgcgcgctgatgctggtgcgcaatgtcggccacctgatgaccacgcccgccgtgctg
gatcgcgacgggggcgaggtctatgaggggctgctggacgccatggtcaccgcgctttgc
gccaagcgcgacctggaccgcgaggggccgaagaactcggtcacgcaatcgatctatgtg
gtgaaacccaagatgcacgggcccgaggaggtcgccttcgcctgcgagatcttcgacttc
gtcgaggatgtgctgggcctgccgcgccataccgtcaagctgggcatcatggacgaggag
cgccgcacctcggctaacctcaaggaatgtatccgcgccgcgaagcaccgcgtggccttc
atcaacaccggcttcctcgaccgcaccggggacgagatccacacctcgatggaggcgggc
gccatgctggccaagggcgagatgaaggcgcagccctggatttcggcctacgaggatcgc
aacgtcgatatcggcctggcctgcgggctggccggcaaggcgcagatcggcaagggcatg
tgggcgatcccggaccggatggccgagatgctggagcagaagatcgcccatcccatggcc
ggcgccaataccgcctgggtgcccagcccgaccgccgcgacgctgcatgcgacgcattac
cacaaggtcgatgtctttgcccgccaggcccagatcgcggcgctgcgccggccctcgcgg
ctggacgacctgctgaccatcccgctggccggcggccgcaactacagcgaggccgagatc
acccgcgagctggagaacaactgccagggcatcctgggctatgtcgtacgctggatcgac
cagggcgtcggctgctcgaaggtgccggacatcaacgatgtcgggctgatggaggaccgc
gccacgctgcgcatctcggcccagtcgctggcgaactggctgcatcacggcatcgtatcg
gacgggcaggtgatggacgccttccgcaagatggccgtggtggtggaccgccagaatgcg
gacgatccggcctatgcgccgatggcgccgggctatgacggcgtggccttccaggcggcc
tgcgacctggtcttcctgggccgcatgcagccctcgggctataccgagccggtgctgcat
gcccgccgcctgcaggccaaggccgagcaggcgcaaaaggccgcgtga

DBGET integrated database retrieval system