KEGG   Paracoccus denitrificans: Pden_4196Help
Entry
Pden_4196         CDS       T00440                                 

Definition
hypothetical protein
Orthology
K09136  
ribosomal protein S12 methylthiotransferase
Organism
pde  Paracoccus denitrificans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(1353021..1354331)
Genome map
AA seq 436 aa AA seqDB search
MRDDAVQAERLGAALVSRRCGLVRELAPQGRGPEEPCPPHLWTATLAHYDFRAAGPSERL
NAGKGRTEAEARLSALGEAIERYSAYHWDASRIRVGPALPGAITPADCVLHSEAQYRAGL
PYPRWSPATETSWIEGVELPSGRPVELPAGLVYLLSPLPRPQDHVAAVTSNGLAAGSDLT
RAVIGGLCELIERDALMITWLNRLPATLIETPETGCMAAAIIRHYRRFGVVVRLLSLATD
QAAFVVMAVAENPDPAQGARIVGMGCDPDPASAVDKAMFELCQARPSMISRLARSDAAER
LRGPEDVRDLDDHPLYHALPRNLGAFDFLFASGSRVRLDDLPRPAAPDPEAVLARLVEAA
NAAGARIAYVDITAPDIAPLGPRVVRCFATGFQPIHFGHGEGRLGGRRLYEAPLRWGLRA
EPLAEADLNPCPHPLA
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgagggacgatgcggtgcaggccgaacggctgggtgcggcgctggtcagccgccgttgc
gggctggtgcgcgaactcgcgccgcagggcaggggccccgaggaaccctgtccgccgcat
ctgtggacggcgacgctggcgcattatgatttccgcgccgccggtccctccgagcggctg
aatgccggcaagggccggaccgaggccgaggcgcggctttccgccctgggcgaggcgatc
gagcggtattcggcctatcactgggacgcctcgcgcatccgcgtcggcccggcgctgccc
ggcgcgatcacccccgccgattgcgtgctgcattccgaggcgcaatatcgcgccggcctg
ccctatccgcgctggagtcccgcgaccgagacgagctggatcgagggggtcgagctgccc
tcgggccggccggtcgaactgccggcggggctggtctatctgctcagcccgctgccacgg
ccccaggatcatgtcgccgccgtcacctcgaacgggctggcggcagggtccgacctgacc
cgcgccgtcatcggcgggctttgcgagttgatcgagcgcgatgcgctgatgatcacctgg
ctcaaccgcctgcccgccacgctgatcgagacgcccgagaccggctgcatggccgccgcg
atcatcaggcactaccgccgcttcggggtcgtggtgcggcttttgtcgctggccaccgac
caggccgccttcgtggtcatggccgtggccgagaacccggacccggcgcagggcgcgcgc
atcgtcggcatgggttgcgaccccgacccggcctctgccgtcgacaaggcgatgttcgag
ctgtgccaggcccggcccagcatgatctcgcgccttgcccgcagcgacgcggccgagcgg
ttgcgcggccccgaggatgtgcgcgacctcgacgaccacccgctttatcatgccctgccg
cgcaatctgggcgcgttcgatttcctgttcgcctcgggcagccgggtgcggctggacgac
ctgccgcgcccggctgccccggaccccgaggcggtgctggcccggctggtcgaggccgcg
aatgccgccggtgcccgcatcgcctatgtcgatatcaccgcgccggacatcgcgccgctt
ggcccgcgcgtggtgcgctgctttgcgaccgggttccagccgatccatttcggccatggc
gagggccgcctgggcgggcgccggctttacgaggcgccgctgcgctggggcctgcgcgcc
gagccgctggccgaggccgacctgaatccctgtccccatccgctggcgtga

DBGET integrated database retrieval system