KEGG   Paracoccus denitrificans: Pden_4219Help
Entry
Pden_4219         CDS       T00440                                 

Definition
nitrous-oxide reductase (EC:1.7.99.6)
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
pde  Paracoccus denitrificans
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Module
Denitrification, nitrate => nitrogen
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:pde00910]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Structure
PDB: 

Jmol
Position
2:complement(1380640..1382598)
Genome map
AA seq 652 aa AA seqDB search
MESKQEKGLSRRALLGATAGGAAVAGAFGGRLALGPAALGLGTAGVATVAGSGAALAASG
DGSVAPGQLDDYYGFWSSGQSGEMRILGIPSMRELMRVPVFNRCSATGWGQTNESLRIHE
RTMSERTKKFLAANGKRIHDNGDLHHVHMSFTEGKYDGRFLFMNDKANTRVARVRCDVMK
CDAILEIPNAKGIHGLRPQKWPRSNYVFCNGEDETPLVNDGTNMEDVANYVNVFTAVDAD
KWEVAWQVLVSGNLDNCDADYEGKWAFSTSYNSEKGMTLPEMTAAEMDHIVVFNIAEIEK
AIAAGDYQELNGVKVVDGRKEASSLFTRYIPIANNPHGCNMAPDKKHLCVAGKLSPTVTV
LDVTRFDAVFYENADPRSAVVAEPELGLGPLHTAFDGRGNAYTSLFLDSQVVKWNIEDAI
RAYAGEKVDPIKDKLDVHYQPGHLKTVMGETLDATNDWLVCLSKFSKDRFLNVGPLKPEN
DQLIDISGDKMVLVHDGPTFAEPHDAIAVHPSILSDIKSVWDRNDPMWAETRAQAEADGV
DIDNWTEEVIRDGNKVRVYMSSVAPSFSIESFTVKEGDEVTVIVTNLDEIDDLTHGFTMG
NYGVAMEIGPQMTSSVTFVAANPGVYWYYCQWFCHALHMEMRGRMLVEPKEA
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atggaatcgaaacaggaaaagggtctcagccgccgcgcgcttttgggcgcgacagccggg
ggcgcggccgtggccggcgcgttcggcggacggctggcgctggggccggcggcgctcggc
ctgggcacggcgggggtcgcgaccgtcgccggcagtggtgcggcgctggccgccagcggc
gacggctcggtcgcgccggggcaactggacgactactacggcttctggtcctcgggccag
agcggcgagatgcgcatccttggcattccctcgatgcgcgagctgatgcgggttccggtc
ttcaaccgctgctcggccaccggctggggccagaccaacgaatcgctgcgcatccatgag
cgcaccatgagcgagcggacgaagaagttccttgccgccaatggcaagcgcatccacgac
aacggcgacctgcaccacgtccacatgtcctttaccgagggcaaatatgacggccgcttc
ctgttcatgaacgacaaggccaatacccgcgtggcgcgggtgcgctgcgacgtgatgaaa
tgcgacgccatcctggagatccccaacgccaagggcatccacggcctgcggccgcagaaa
tggccgcgcagcaactatgtcttctgcaatggcgaggacgagacgccgctggtcaacgac
ggcaccaacatggaggacgtggcgaattacgtgaacgtcttcaccgccgtcgatgccgac
aagtgggaggtcgcctggcaggtgctcgtctcgggcaacctggacaactgcgatgccgat
tacgagggcaaatgggccttttcgacctcctacaactcggaaaaggggatgaccctgccc
gagatgacggcggccgagatggaccatatcgtcgtcttcaacatcgccgagatcgaaaag
gccatcgctgccggcgactatcaggaactgaacggcgtcaaggtcgtggatggccggaaa
gaggcaagcagcctgttcacccgctatatccccatcgccaacaacccgcatggctgcaac
atggcgccggacaagaagcacctgtgcgtcgcgggcaagctgtcgcccacggtgacggtg
ctggacgtgacccggttcgacgcggtgttctatgagaacgccgatccgcgcagcgccgtg
gtggccgagccggaactgggccttggcccgctgcacaccgccttcgacgggcgcggcaac
gcctatacctcgctgttcctcgacagccaggtggtcaagtggaacatcgaggatgccatc
cgcgcctatgccggcgagaaggtcgacccgatcaaggacaagctggacgtgcattaccag
cccggccacctcaagaccgtgatgggcgagacgctggacgccaccaacgactggctggtc
tgcctgtccaagttctcgaaggaccgcttcctgaacgtcgggccgctgaagccggagaac
gaccagctgatcgacatctcgggcgacaagatggtgctggtccatgacggccccaccttt
gccgagccgcacgacgccatcgccgtgcacccctcgatcctgtccgacatcaagtcggtc
tgggaccgcaacgacccgatgtgggccgagacccgcgctcaggccgaggccgatggcgtc
gacatcgacaactggaccgaagaggtgatccgcgacggcaacaaggtgcgggtctacatg
tccagcgtggcgccgagcttctcgatcgagagctttaccgtcaaggagggcgacgaggtc
acggtgatcgtcaccaacctggacgagatcgacgatctgacgcatggcttcaccatgggc
aactacggcgtcgccatggagatcgggccgcagatgaccagctcggtcaccttcgtcgcc
gccaatcccggggtctattggtattattgccaatggttctgccatgcgctgcacatggag
atgcgcggccgcatgctggtcgagccgaaggaggcctga

DBGET integrated database retrieval system