KEGG   Paracoccus denitrificans: Pden_4305Help
Entry
Pden_4305         CDS       T00440                                 

Definition
Triose-phosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pde  Paracoccus denitrificans
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:pde01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:pde01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pde00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:pde00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:pde00562]
Metabolism; Energy metabolism; Carbon fixation in photosynthetic organisms [PATH:pde00710]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:1484756..1485499
Genome map
AA seq 247 aa AA seqDB search
MAPRKLAAGNWKMNGTLAALAEIDRLLADHPAPGCEVLICPPATLIHPMAARSQGRIAVG
GQDCHAKTSGAHTGDIAAAQLRDAGSSHVILGHSERRTDHAETDEQVRAKAAAAHEAGLV
AVICVGETEVQRDAGQTLDVISAQLAGSVPDGATAANTVIAYEPVWAIGTGRTPTSDQIA
EVHALMRERLSARLGDGADFALLYGGSVKPGNAAEIFAIPHVNGALVGGASLKAEDFGPI
IAALSAA
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggccccgcgcaagctcgccgccggcaactggaagatgaacggaaccctggccgcactg
gccgagatcgaccggctgctggccgatcacccggcacccggctgcgaggtgctgatctgc
ccgcccgccacgctgatccaccccatggccgcccgcagccagggcaggatcgctgtcggc
ggccaggattgccacgccaagacctcgggcgcccataccggcgacatcgccgccgcccag
cttcgcgatgcgggctcgagccacgtcatcctcggccattccgagcgtcgcaccgaccat
gccgagaccgacgaacaggtgcgcgccaaggcggccgccgcgcatgaggctgggcttgtc
gcggtgatctgcgtcggcgagaccgaggtgcagcgggacgccggccagacgctcgacgtg
atctcggcccagcttgccggctcggtcccggatggcgcgacggccgcgaacacggtgatc
gcctatgagccggtctgggccatcggcaccggccgcacgcccacctccgaccagatcgcc
gaggtgcatgccctgatgcgcgagcgcctgtcggcccgtctgggcgacggcgccgacttc
gccctgctctacggcggttcggtcaagccgggcaacgcggccgagatatttgccatcccg
catgtgaacggcgcgctggtcggcggcgccagcctcaaggccgaggatttcggcccgatc
atcgccgcgctttccgcagcgtaa

DBGET integrated database retrieval system