KEGG   Paracoccus denitrificans: Pden_4305Help
Entry
Pden_4305         CDS       T00440                                 

Definition
Triose-phosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pde  Paracoccus denitrificans
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pde00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pden_4305
   01230 Biosynthesis of amino acids
    Pden_4305
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pden_4305
   00051 Fructose and mannose metabolism
    Pden_4305
   00562 Inositol phosphate metabolism
    Pden_4305
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Pden_4305
Enzymes [BR:pde01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Pden_4305
Exosome [BR:pde04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Pden_4305
  Exosomal proteins of bladder cancer cells
   Pden_4305
  Exosomal proteins of melanoma cells
   Pden_4305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:1484756..1485499
Genome map
AA seq 247 aa AA seqDB search
MAPRKLAAGNWKMNGTLAALAEIDRLLADHPAPGCEVLICPPATLIHPMAARSQGRIAVG
GQDCHAKTSGAHTGDIAAAQLRDAGSSHVILGHSERRTDHAETDEQVRAKAAAAHEAGLV
AVICVGETEVQRDAGQTLDVISAQLAGSVPDGATAANTVIAYEPVWAIGTGRTPTSDQIA
EVHALMRERLSARLGDGADFALLYGGSVKPGNAAEIFAIPHVNGALVGGASLKAEDFGPI
IAALSAA
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggccccgcgcaagctcgccgccggcaactggaagatgaacggaaccctggccgcactg
gccgagatcgaccggctgctggccgatcacccggcacccggctgcgaggtgctgatctgc
ccgcccgccacgctgatccaccccatggccgcccgcagccagggcaggatcgctgtcggc
ggccaggattgccacgccaagacctcgggcgcccataccggcgacatcgccgccgcccag
cttcgcgatgcgggctcgagccacgtcatcctcggccattccgagcgtcgcaccgaccat
gccgagaccgacgaacaggtgcgcgccaaggcggccgccgcgcatgaggctgggcttgtc
gcggtgatctgcgtcggcgagaccgaggtgcagcgggacgccggccagacgctcgacgtg
atctcggcccagcttgccggctcggtcccggatggcgcgacggccgcgaacacggtgatc
gcctatgagccggtctgggccatcggcaccggccgcacgcccacctccgaccagatcgcc
gaggtgcatgccctgatgcgcgagcgcctgtcggcccgtctgggcgacggcgccgacttc
gccctgctctacggcggttcggtcaagccgggcaacgcggccgagatatttgccatcccg
catgtgaacggcgcgctggtcggcggcgccagcctcaaggccgaggatttcggcccgatc
atcgccgcgctttccgcagcgtaa

DBGET integrated database retrieval system