KEGG   Paracoccus denitrificans: Pden_4424Help
Entry
Pden_4424         CDS       T00440                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
pde  Paracoccus denitrificans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pde00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Pden_4424
Enzymes [BR:pde01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Pden_4424
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(1626280..1628115)
Genome map
AA seq 611 aa AA seqDB search
MTDPRLILAERMGVLPGFHDLGGQWRETSVETAAALLAAMGLAVPTAAEAQAALEAHADR
LPRDVICAAGSRPDLAVGDWQVTFENGAQQEGRGPLPALPLGIHRLQAGGRDYTLLAAPP
RLPEPARCWGLIAPLYGISQAGIGSYADLAVLARGMGGQGAAFLGMNPVHAGFPTVPHLF
SPYTPSHRRRLNVIHLPGGAGTPGPRVDYARDIPARMAALRAEYDAFPGDPAFDAWQAAE
GEGLQRFALHQALSARLGAFWSDWPATLASPDTLAALAARAELAGEMRFHAWLQWRAERA
LAAAGQAARDGGMAHGLYLDLAVGTHPFGAETWEDRASFAFGASLGAPPDGFAPEGQNWS
LAPFNPLGLRAQAYAPLAETLRRQLQFAGVLRIDHILGFERAFWVPDAAPGAYVAMPRDA
MLAVARIEAGRAGDAVIVGEDLGNIPEGLRDALAASGILGCRVAMFERDGWHPPVFRPAE
AYDRGAIASFSTHDLPTWRGWRQGGDIGARGRISGQDTATQHSERAAEVAGFDRLLPDPG
VDALHGFLARTPSRLVAVQAELLLDMADQPNLPGTVGEYPNWQLRLPVAAGDFPALPSVA
RTASIMRDHER
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
gtgactgatccgcgcctgatcctggcggaacggatgggcgtgctgccgggctttcacgac
cttggcgggcaatggcgcgagacctcggtcgagaccgccgcggcgctgcttgccgccatg
gggcttgccgtgcccaccgcggccgaggcgcaggcggcgctggaggctcacgccgaccgc
ctgccgcgggacgtgatctgcgccgccggttcccgccccgacctggccgtcggcgactgg
caggtgacgttcgagaatggcgcccaacaggagggccgcggcccgctgcccgcgctgccg
ctgggcatccaccgtttgcaggccgggggccgggactatacgctgcttgccgcgccgccg
cgcctgcccgagccggcgcggtgctgggggctgatcgcgccactttacggcatctcgcag
gcggggatcggcagctatgccgaccttgcggtgctggcgcggggcatgggcgggcagggc
gcggctttcctgggcatgaacccggtccatgccggcttcccgaccgtgccgcatctcttc
agcccctacaccccgtcgcatcgccggcggctgaacgtgatccacctgcccggcggcgcg
ggcacccccggcccgcgtgtcgattacgcccgcgacatcccggcccgcatggcggcgttg
cgcgcggaatacgacgcctttccgggcgatccggcctttgacgcctggcaggcggccgag
ggcgagggcctgcagcgctttgccctgcatcaggcgctgtcggcccggctgggcgccttc
tggagcgattggccggcgacgcttgcctcgcccgacacgctcgccgcccttgccgcgcgc
gcggaactggccggcgagatgcgctttcatgcctggctgcaatggcgggccgagcgggcg
ctggcggcggccgggcaggcggcgcgcgacggaggcatggcgcatgggctctatctcgac
ctcgccgtgggcacccatcccttcggtgccgagacatgggaggatcgcgccagcttcgcc
tttggcgcctcgcttggcgcgccgcccgacggttttgcgcccgaggggcagaactggtcg
ctggcacccttcaacccgctgggcctgcgcgcccaggcctatgcgccgctggccgaaacc
ctgcgccgccagctgcaattcgcgggcgtgctgcgcatcgaccacatcctgggcttcgag
cgcgccttctgggtgcccgatgcggcacccggcgcctatgtcgccatgccgcgcgacgcc
atgctggccgtggcccggatcgaggccgggcgtgcaggcgatgccgtcatcgtcggcgag
gatctgggcaatatccccgaggggctgcgcgatgcgctggccgcctcgggcatcctcggc
tgccgcgtcgcgatgttcgagcgcgacggctggcatccgcccgtctttcgccctgccgaa
gcctatgaccgcggcgccatcgccagcttttcgacccatgacctgccgacgtggcgcggc
tggcggcagggtggcgatataggggcccgcggccgtatctccggccaggacaccgccacc
cagcacagcgaacgcgccgcggaggtcgcgggcttcgaccggctcctgcccgatcccggc
gtcgatgcgctgcacggctttctggcccgcacgccgtcgcggctggtggcggtgcaggcc
gaactgctgcttgacatggccgaccagccgaacctgcccggcacggtcggcgaatatccg
aactggcagctgcgcctgccggtggcggccggggatttcccggcattgccctcggtcgcg
cggactgccagcatcatgcgtgaccacgaacgctaa

DBGET integrated database retrieval system