KEGG   Paracoccus denitrificans: Pden_4512Help
Entry
Pden_4512         CDS       T00440                                 

Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
pde  Paracoccus denitrificans
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:pde03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:1727837..1728682
Genome map
AA seq 281 aa AA seqDB search
MPELPEVETVRRGLQPHLEGRVIARAEARRPDLRWPLPPDLVQVLTGARVVALRRRSKYI
LAELEDRGSLLLHLGMSGRMLIEGESQGDFHRDPAILPRHDHVVLWNDQGTRITFNDARR
FGMVDLVPPGAEHPLLAHLGPEPLSDAFTAEALAAAFAGRRMPVKAALLDQRIVAGLGNI
YVSEALYRAGIDPRRLAGAVTAPEVAALVGHVRAVLEEAIAAGGSSLRDHRQATGELGYF
QHSFRVYGREGAPCPTPGCTGTVQRIVQSGRSSFFCPLCQQ
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgccagaactgccagaggtcgaaaccgtccgacgcggccttcagccgcatctcgaaggc
cgggtgatcgcccgtgccgaagcccgccgccccgacctgcgctggcccctgccgcccgat
ctggtgcaggtgctgaccggcgcgcgggtcgtcgccctgcggcggcgctcgaaatacatc
ctggccgagctggaggatcgcggcagcctgcttctgcatctgggcatgtcggggcggatg
ctaatcgagggggaaagccagggcgatttccaccgcgacccggcgatcctgccgcgccac
gaccatgtggtgctgtggaacgaccagggcacgcgcatcaccttcaacgacgcgcggcga
ttcggcatggtcgatctggtgccgccgggggccgagcatccgctgctggcgcatctgggg
cccgagccgctgtcggacgccttcaccgccgaggcgctggcggcggccttcgccgggcgg
cgcatgccggtcaaggcagcgctgctcgaccagcgaatcgtggcggggctgggcaatatc
tacgtctccgaggcgctctatcgcgccggcatcgacccgcgccgtctggccggagcggtc
accgcccccgaggtggcggcgctggtcggccatgtccgtgccgttctggaggaggcgatc
gcggccgggggctccagcctgcgcgaccaccggcaggcgaccggagagctgggctatttc
cagcactccttccgcgtctatggccgcgagggtgcgccctgcccgacgccgggctgcacg
ggcacggtccagcgcatcgtgcagtccgggcggtcgagctttttctgcccgctctgccag
cagtga

DBGET integrated database retrieval system