KEGG   Paracoccus denitrificans: Pden_4550Help
Entry
Pden_4550         CDS       T00440                                 

Definition
acetate--CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pde  Paracoccus denitrificans
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pde01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pde00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:pde00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:pde00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:pde00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
p1:31432..33387
Genome map
AA seq 651 aa AA seqDB search
MTIETSGKHPIPPGFGDALVQPGDYARMYAESISDPDGFWGREGRRLDWIHPYSRVKNTD
FAMGQVSVKWFEDGILNASVNCIDRHLPGRANQAAIIFEPDDPDQPARHITYAELSEKVN
RFANVLLSQGVMRGDRVVIYLPMIPEAAYAMLACARIGAIHSIVFAGFSPDALANRINDS
GAKLVITADTAPRGGRKTALKSNTDAALLHCSDRVRCLVVRHTGDQTSWIDGRDVDVLAM
MEQVSPDCPPRPMNAEDPLFILYTSGSTGKPKGVVHSTAGYLLYAAMTHQYVFDYKDGDI
FWCTADVGWVTGHSYIVYGPLANGATTLMFEGVPTWPDAGRFWAVCEKHGVNQFYTAPTA
IRALMGQGPEWVEKHDLSSLRVLGTVGEPINPEAWVWYDRHVGKGRCPIVDTWWQTETGG
HMITSLPGAIEAKPGSATLPFFGVRPVVLDASSGAVQEGDGVEGVLCIADSWPGQMRTVW
GDHQRFMETYFQQYPGYYFTGDGCRRDEDGYYWITGRVDDVINVSGHRMGTAEVESALVA
HEKVAEAAVVGYPHPLKGQGIYAYVTLMNGVEPSDELRADLEKWVRTEIGPIAKPDLIQW
APGLPKTRSGKIMRRILRKIAEDDFGALGDISTLADPGVVDQLIENRMNRA
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgaccattgaaacttctgggaaacatccgattccgccgggttttggggatgccctggtc
cagcctggcgattacgcccgcatgtatgccgaatcgatctcggaccctgacgggttctgg
ggccgcgagggcaggcggctggactggatccacccctattccagggtgaagaacaccgat
ttcgccatgggccaggtctcggtgaagtggttcgaggacggcatcctgaacgcctcggtc
aactgcatcgaccgccacctgcccgggcgcgcgaaccaggccgcgatcatcttcgagccg
gacgacccggaccagccggcgcgccacatcacctatgcggaactgtcggaaaaggtgaac
cgcttcgccaacgtgctgctgagccagggggtgatgcgcggcgaccgggtggtgatctac
ctgccgatgatccccgaggcggcctatgccatgctggcctgcgcgcggatcggcgccatc
cactccatcgtcttcgccggcttctcgcccgacgcgctggccaaccgcatcaacgacagc
ggcgccaagctggtgatcaccgccgacaccgcgccgcgcggcggccgcaagacggcgctg
aagtcgaataccgacgcggcgctgctgcattgctcggaccgggtgcgctgcctggtggtc
aggcataccggcgaccagaccagctggatcgacgggcgcgacgtggacgtgctggcgatg
atggagcaggtcagcccggattgcccgccgcggccgatgaatgccgaggacccgctgttc
atcctctatacctcgggctcgacgggcaagcccaagggcgtggtgcattcgaccgccggc
tacctgctttatgccgcgatgacgcatcaatacgtcttcgactacaaggacggcgacatc
ttctggtgcacggccgacgtggggtgggtgacggggcacagctatatcgtctacggcccg
ctggccaacggcgccacgacgctgatgttcgagggcgtgccgacctggccggatgccggc
cgcttctgggcggtctgcgaaaagcacggggtcaaccagttctacaccgcgccgaccgcc
atccgggcgctgatggggcaggggccggaatgggtcgagaagcacgacctgtccagcctg
cgggtgctgggcacggtgggcgagccgatcaaccccgaggcctgggtctggtacgaccgg
catgtgggcaaggggcgctgcccgatcgtcgacacctggtggcagaccgagaccgggggt
cacatgatcacctcgctgcccggcgcgatcgaggccaagccgggctcggcgacgctgccc
ttcttcggggtcaggccggtggttctggatgcctcgagcggggcggtgcaggagggcgac
ggggtcgagggggtgctgtgcatcgccgacagctggccggggcagatgcgcacggtctgg
ggcgaccaccagcgcttcatggagacctatttccagcaatatccgggctattacttcacc
ggcgacggctgccggcgggacgaggacggctattactggatcaccgggcgggtggacgac
gtgatcaacgtctcgggccaccggatgggcacggccgaggtggaatcggcgctggtggcg
catgagaaggtggccgaggcggcggtggtgggctatccgcacccgctgaagggccagggc
atctatgcctatgtgacgctgatgaacggggtcgagcccagcgacgagctgcgcgccgac
cttgagaaatgggtgcgcaccgagatcggcccgatcgccaagcccgacctgatccaatgg
gcgccgggcctgcccaagacccgttcgggcaagatcatgcgccgcatcctgcgcaagatc
gccgaggacgatttcggcgccctcggagacatctccacgctcgcagacccgggcgtcgtg
gaccaactcatcgaaaacagaatgaaccgcgcctga

DBGET integrated database retrieval system