KEGG   Paracoccus denitrificans: Pden_4550Help
Entry
Pden_4550         CDS       T00440                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pde  Paracoccus denitrificans
Pathway
pde00010  Glycolysis / Gluconeogenesis
pde00620  Pyruvate metabolism
pde00640  Propanoate metabolism
pde00680  Methane metabolism
pde01100  Metabolic pathways
pde01110  Biosynthesis of secondary metabolites
pde01120  Microbial metabolism in diverse environments
pde01130  Biosynthesis of antibiotics
pde01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pde00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pden_4550
   00620 Pyruvate metabolism
    Pden_4550
   00640 Propanoate metabolism
    Pden_4550
  Energy metabolism
   00680 Methane metabolism
    Pden_4550
Enzymes [BR:pde01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Pden_4550
Lipid biosynthesis proteins [BR:pde01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Pden_4550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABL72613
JGI: Pden4550
UniProt: A1BAR9
Position
p1:31432..33387
Genome map
AA seq 651 aa AA seqDB search
MTIETSGKHPIPPGFGDALVQPGDYARMYAESISDPDGFWGREGRRLDWIHPYSRVKNTD
FAMGQVSVKWFEDGILNASVNCIDRHLPGRANQAAIIFEPDDPDQPARHITYAELSEKVN
RFANVLLSQGVMRGDRVVIYLPMIPEAAYAMLACARIGAIHSIVFAGFSPDALANRINDS
GAKLVITADTAPRGGRKTALKSNTDAALLHCSDRVRCLVVRHTGDQTSWIDGRDVDVLAM
MEQVSPDCPPRPMNAEDPLFILYTSGSTGKPKGVVHSTAGYLLYAAMTHQYVFDYKDGDI
FWCTADVGWVTGHSYIVYGPLANGATTLMFEGVPTWPDAGRFWAVCEKHGVNQFYTAPTA
IRALMGQGPEWVEKHDLSSLRVLGTVGEPINPEAWVWYDRHVGKGRCPIVDTWWQTETGG
HMITSLPGAIEAKPGSATLPFFGVRPVVLDASSGAVQEGDGVEGVLCIADSWPGQMRTVW
GDHQRFMETYFQQYPGYYFTGDGCRRDEDGYYWITGRVDDVINVSGHRMGTAEVESALVA
HEKVAEAAVVGYPHPLKGQGIYAYVTLMNGVEPSDELRADLEKWVRTEIGPIAKPDLIQW
APGLPKTRSGKIMRRILRKIAEDDFGALGDISTLADPGVVDQLIENRMNRA
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgaccattgaaacttctgggaaacatccgattccgccgggttttggggatgccctggtc
cagcctggcgattacgcccgcatgtatgccgaatcgatctcggaccctgacgggttctgg
ggccgcgagggcaggcggctggactggatccacccctattccagggtgaagaacaccgat
ttcgccatgggccaggtctcggtgaagtggttcgaggacggcatcctgaacgcctcggtc
aactgcatcgaccgccacctgcccgggcgcgcgaaccaggccgcgatcatcttcgagccg
gacgacccggaccagccggcgcgccacatcacctatgcggaactgtcggaaaaggtgaac
cgcttcgccaacgtgctgctgagccagggggtgatgcgcggcgaccgggtggtgatctac
ctgccgatgatccccgaggcggcctatgccatgctggcctgcgcgcggatcggcgccatc
cactccatcgtcttcgccggcttctcgcccgacgcgctggccaaccgcatcaacgacagc
ggcgccaagctggtgatcaccgccgacaccgcgccgcgcggcggccgcaagacggcgctg
aagtcgaataccgacgcggcgctgctgcattgctcggaccgggtgcgctgcctggtggtc
aggcataccggcgaccagaccagctggatcgacgggcgcgacgtggacgtgctggcgatg
atggagcaggtcagcccggattgcccgccgcggccgatgaatgccgaggacccgctgttc
atcctctatacctcgggctcgacgggcaagcccaagggcgtggtgcattcgaccgccggc
tacctgctttatgccgcgatgacgcatcaatacgtcttcgactacaaggacggcgacatc
ttctggtgcacggccgacgtggggtgggtgacggggcacagctatatcgtctacggcccg
ctggccaacggcgccacgacgctgatgttcgagggcgtgccgacctggccggatgccggc
cgcttctgggcggtctgcgaaaagcacggggtcaaccagttctacaccgcgccgaccgcc
atccgggcgctgatggggcaggggccggaatgggtcgagaagcacgacctgtccagcctg
cgggtgctgggcacggtgggcgagccgatcaaccccgaggcctgggtctggtacgaccgg
catgtgggcaaggggcgctgcccgatcgtcgacacctggtggcagaccgagaccgggggt
cacatgatcacctcgctgcccggcgcgatcgaggccaagccgggctcggcgacgctgccc
ttcttcggggtcaggccggtggttctggatgcctcgagcggggcggtgcaggagggcgac
ggggtcgagggggtgctgtgcatcgccgacagctggccggggcagatgcgcacggtctgg
ggcgaccaccagcgcttcatggagacctatttccagcaatatccgggctattacttcacc
ggcgacggctgccggcgggacgaggacggctattactggatcaccgggcgggtggacgac
gtgatcaacgtctcgggccaccggatgggcacggccgaggtggaatcggcgctggtggcg
catgagaaggtggccgaggcggcggtggtgggctatccgcacccgctgaagggccagggc
atctatgcctatgtgacgctgatgaacggggtcgagcccagcgacgagctgcgcgccgac
cttgagaaatgggtgcgcaccgagatcggcccgatcgccaagcccgacctgatccaatgg
gcgccgggcctgcccaagacccgttcgggcaagatcatgcgccgcatcctgcgcaagatc
gccgaggacgatttcggcgccctcggagacatctccacgctcgcagacccgggcgtcgtg
gaccaactcatcgaaaacagaatgaaccgcgcctga

DBGET integrated database retrieval system