KEGG   Paracoccus denitrificans: Pden_4596Help
Entry
Pden_4596         CDS       T00440                                 

Definition
Fis family transcriptional regulator
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
pde  Paracoccus denitrificans
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:pde00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
p1:complement(79304..79981)
Genome map
AA seq 225 aa AA seqDB search
MTDEERALRLELIESCRAMNRLGINKGTSGNISVRYGDGFLISPTGIPYDKLQPEHVVAM
NWDATYEGAVQPSSEWRFHRDILQARPDLNAVVHTHSTHATALSILGREIPAIHYVIAAA
GGNSIRCAPYELFGTQELADRVVAALEGRRACLMAHHGVIAAHATIARALALAVTVEELA
RQYLLCLPLGEPPVLSDEQIAEVLVKFKTYGQQSSAALEGLRQAS
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgaagaacgcgccctgcgtcttgagctgatcgaatcctgccgcgccatgaac
cggctgggcatcaacaagggcacctcgggcaatatcagcgtccgttacggcgacggcttc
ctgatctcgcccaccggcatcccctatgacaagctgcaaccggaacatgtcgtggcgatg
aactgggacgcgacctatgaaggcgcggtccagccctcgtccgaatggcgctttcatcgc
gacatcctgcaggcgcggcccgacctgaacgcggtggtgcatacccattcgacccatgcc
acggcgctgtcgatcctggggcgcgaaatccctgcgatccattacgtcatcgccgccgcc
ggcggcaacagcatccgctgcgcaccctatgaactgttcggcacgcaggaactggccgac
cgcgtggtcgccgcgctggaggggcgccgcgcctgcctgatggcgcatcacggcgtcatc
gccgcccatgccactatcgcccgtgcactggcgctggccgtcacggtcgaggaactggcc
aggcaatacctgctgtgcttgcccctgggcgagccgccggtgctgtcggacgagcagatc
gccgaagtcctggtcaagttcaagacctatggccagcaaagcagcgccgcgctggaaggg
ctgcgccaggcgtcctga

DBGET integrated database retrieval system