KEGG   Paracoccus denitrificans: Pden_4983Help
Entry
Pden_4983         CDS       T00440                                 

Definition
(GenBank) alpha/beta hydrolase fold protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pde  Paracoccus denitrificans
Pathway
pde00010  Glycolysis / Gluconeogenesis
pde00020  Citrate cycle (TCA cycle)
pde00620  Pyruvate metabolism
pde01100  Metabolic pathways
pde01110  Biosynthesis of secondary metabolites
pde01120  Microbial metabolism in diverse environments
pde01130  Biosynthesis of antibiotics
pde01200  Carbon metabolism
Module
pde_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pde00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pden_4983
   00020 Citrate cycle (TCA cycle)
    Pden_4983
   00620 Pyruvate metabolism
    Pden_4983
Enzymes [BR:pde01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Pden_4983
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Biotin_lipoyl Thioesterase Abhydrolase_5 Esterase_phd Esterase PGAP1 Biotin_lipoyl_2 Abhydrolase_8 DUF2048 Abhydrolase_4
Motif
Other DBs
NCBI-ProteinID: ABL73043
JGI: Pden4983
UniProt: A1BBZ9
Position
p1:complement(493422..494525)
Genome map
AA seq 367 aa AA seqDB search
MADITPILMPKWGLSMKEGKLAAWHVAEGAEIKPGDEIMDVETDKIANVVEAADGGLLRR
RIGVEGETYPVRALLAVMAPPSVAEDEIDAYVAAYETPSAGDDEGEEGPSYQFADLPAGR
IRYAERPGEGMPLILIHGFGGDLDNWLFNIDALAENAPVYALDLPGHGQSVKSARPAGLE
LMVQTVIAFMDHLGIDKAHLAGHSMGGLVAGTLAAQHPARVASVTLICSAGLGSEINSDY
IDGFVRAAGRKDLKPVLAHLFKDQSLVSRAMVEDLLKYKRLDGVQDFLTELAGSLFREGR
QAQQVAEALAASGVPAQVIWGEADAVIPAAHAESLQGASRHVVSGAGHMVQMEQSAEVNR
LIRDFIA
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggcagacatcactccgatcctgatgccgaaatggggcctgtcgatgaaggagggcaag
cttgccgcctggcatgtcgccgagggcgccgagatcaagcccggcgacgagatcatggat
gtcgagaccgacaagatcgccaatgtggtcgaggctgccgacggcgggctcttgcgccgc
cgcatcggcgtcgagggcgagacctatccggtgcgcgcgcttctggccgtcatggcgccg
ccttcggtcgcggaggacgagatcgacgcctatgtcgcggcctacgagaccccttcggcc
ggtgacgacgagggcgaggaaggcccgagctatcagttcgccgacctgcccgccggccgc
atccgctatgccgagcgaccgggcgagggcatgcccctgatcctgatccacggcttcggc
ggcgatctggacaactggctgttcaacatcgacgcgctggcggaaaacgcgcccgtctat
gcgctggacctgcccggtcatggccagtcggtgaaatcggcgcgcccggcagggctggag
ctgatggtccagaccgtgatcgccttcatggaccatctgggcatcgacaaggcgcatctg
gccggccattccatgggcgggctggttgccggcacgctggcggcgcagcatcccgcgcgc
gtcgcctcggtcacgctgatctgttcggcggggctcgggtccgagatcaactcggactat
atcgacggcttcgtgagggccgccggtcgcaaggacctgaagccggtgctggcgcatctg
ttcaaggatcagtcgctggtcagccgcgcgatggtcgaggatttgctgaaatacaagcgc
ctcgacggcgtgcaggacttcctgaccgaactggccggcagcctgttccgcgagggccgg
caggcccagcaggtggccgaggcgctggccgcctcgggcgtgccggcgcaggtgatctgg
ggcgaggccgatgccgtcatccctgccgcccatgccgaaagcctgcaaggcgcgtcccgc
catgtggtctctggggcgggccacatggtgcagatggagcaatcggccgaggtgaaccgc
ctgatccgcgacttcatcgcctga

DBGET integrated database retrieval system