KEGG   Clostridioides difficile: CD630DERM_29700Help
Entry
CD630DERM_29700   CDS       T03785                                 

Definition
(GenBank) putative thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pdf  Clostridioides difficile 630Derm
Pathway
pdf00071  Fatty acid degradation
pdf00072  Synthesis and degradation of ketone bodies
pdf00280  Valine, leucine and isoleucine degradation
pdf00310  Lysine degradation
pdf00362  Benzoate degradation
pdf00380  Tryptophan metabolism
pdf00620  Pyruvate metabolism
pdf00630  Glyoxylate and dicarboxylate metabolism
pdf00640  Propanoate metabolism
pdf00650  Butanoate metabolism
pdf00900  Terpenoid backbone biosynthesis
pdf01100  Metabolic pathways
pdf01110  Biosynthesis of secondary metabolites
pdf01120  Microbial metabolism in diverse environments
pdf01130  Biosynthesis of antibiotics
pdf01200  Carbon metabolism
pdf01212  Fatty acid metabolism
pdf02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pdf00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CD630DERM_29700
   00630 Glyoxylate and dicarboxylate metabolism
    CD630DERM_29700
   00640 Propanoate metabolism
    CD630DERM_29700
   00650 Butanoate metabolism
    CD630DERM_29700
  Lipid metabolism
   00071 Fatty acid degradation
    CD630DERM_29700
   00072 Synthesis and degradation of ketone bodies
    CD630DERM_29700
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CD630DERM_29700
   00310 Lysine degradation
    CD630DERM_29700
   00380 Tryptophan metabolism
    CD630DERM_29700
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CD630DERM_29700
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CD630DERM_29700
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CD630DERM_29700
Enzymes [BR:pdf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CD630DERM_29700
Exosome [BR:pdf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CD630DERM_29700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CEJ99609
Position
1:complement(3408944..3410080)
Genome map
AA seq 378 aa AA seqDB search
MKKVFILGGLRSHIGLKNGIFQFVQPELLGASVLKDLIKKYEIDKIDEIICGNAVGTGGN
IARLMTLTAGVSNEVPAFTVDMQCASAMMSIDIAFSKVKSGQCDLIIAGGFESSSLQPMR
TYHKNDKRYNTNNPNYTVAQFSPDDNSQNSMLEGAERVAELYQIEKADLDFWVKESHKRA
KEAREEKILEDIISPINNSTCDEGIRDKMSQRLLDRMPSILGKETITNAANSCLINDGAS
FIIICSKKYLEHVKKKPKAKIINTCTIGTDATLSPTSAIQAMDKLLEIESINYLDVSAVE
FNEAFAVIDVLFQRKYPELIDRYNIFGGALAYGHPYGASGAIIALHLLKALEKTKGRYGI
CSIAAAGGLGSALLLERV
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaagtttttatattaggaggattgagaagtcatataggtctaaaaaatggaatt
tttcaatttgttcaacctgaattactaggagcaagtgttttaaaagatttaattaaaaag
tatgaaattgacaaaattgatgagattatatgtggaaatgcagttgggacaggagggaat
atagctagattaatgactttaacagcaggagtgtcaaatgaagtacctgcttttactgtg
gatatgcagtgtgcttctgctatgatgagtatagacatagctttttcaaaggttaaatct
ggtcagtgtgatttaattattgcaggtggttttgaaagtagttctctacaaccaatgcgc
acatatcataagaatgataagcgatataatacaaataatccaaattatacagttgctcaa
ttttctcctgatgataatagccaaaatagtatgctcgaaggggcggaaagagtagcagag
ttatatcaaattgagaaagcagacttggatttttgggtaaaggaaagtcataaaagagca
aaagaagcaagagaagaaaaaatacttgaggatattatatctcctataaataatagtacc
tgtgatgaaggtatacgtgataagatgagtcaaaggttattagataggatgccatcaatt
ttaggaaaagaaactattacaaatgcagcaaattcatgtcttattaatgatggagcttca
tttattataatatgttctaagaagtatttagaacatgtaaaaaagaagcctaaagcaaaa
attattaatacatgcacaataggaacagatgcaaccttaagtccaacatcagcgatacaa
gcaatggataaacttttagagatagaaagcattaattatttagatgtatctgctgttgaa
tttaatgaagcatttgcagttatagatgtgttgtttcaaagaaagtatccagagttaata
gatagatataatatatttggtggagctttagcgtatggacatccatatggtgcttcaggt
gcaattattgcattacatcttttaaaagcattagaaaagactaagggtagatatggaatt
tgctctatagctgcagctggtggtctaggttcagctttactgcttgaaagggtgtag

DBGET integrated database retrieval system