KEGG   Parabacteroides distasonis: BDI_0003Help
Entry
BDI_0003          CDS       T00549                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
pdi  Parabacteroides distasonis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pdi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BDI_0003
Enzymes [BR:pdi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     BDI_0003
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4220..6907
Genome map
AA seq 895 aa AA seqDB search
MKVSFNINFHTVWGQKLCVVGSIPELGSWEPALAKEMNYSGDGNWKLELDLPPDIKDIEY
RYFLSVNDKQIFEEWEKNHRIVLDGQSDSYILYDYWQIRPDNLAFYSSAFTKSLFAHPCN
THERVVRSGRKLVIKISAPRVEKNQCVAITGNQECLGNWHPDKALLLSCDTFPEWHIDLD
AAEIRYPLEYKFLVWDNDSRQPLYWESDENRILSLVPQKQGETVVISGLYFRDSLPLWRC
AGSVIPVFSLRSEKSFGVGDLGDLHMLVDWARKTHQRIIQVLPMNDTTMTHTWVDSYPYS
AISIYALHPMYVDLSALGTLKDPERAAFYAGKQKELNAKDTVDYEEVLKYKLGYCQEYFA
GEGKAVLDTPEFKEFLAQNESWLMPYATYCFLRESYGTSDFSQWQGNSTYNKTRVRALCR
EDSDAWPEISFSYFLQYVLHNQFKSVSDYARKNGVVLKGDLPIGVSRTSVEAWTEPKYFN
MNGQAGAPPDDFSMNGQNWLFPTYNWDAMEKDNFSWWKKRFAKLSDYFDCFRIDHILGFF
RIWEVPCEYVQGLCGHFNPALPFSREEIEQYGLNFNESRFTTPHINRQFLSELFEENTEE
VIGAYLAQSSSRHYVLKPFCDTQRKIEALFADKADPVSLRIKNGLFTIANEVLFLRDPRE
TDKFHPRISANQSYIYRELSGSDRYAFDQLYWHFFYHRHNDFWKAQAFKRLTPLVASTEM
LVCGEDLGMIPASVPEVMNKLQILSLEIERMPKSPQREFSDMFNLPYHSVCTTSTHDMTP
LRNWWKEDPEKTQRYYNHVLQRIGEAPDECTAEIVAQIISNHLKTRSMLTIIPLQDWFAM
DDSIKRKDIESERINVPANSTHYWRYRMHITLEQLLQADNLNNKIVSLIKEAGRK
NT seq 2688 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtctcttttaatataaacttccataccgtttggggacagaagttatgtgtagtg
ggctccataccggaattaggctcttgggaacctgctttggctaaggagatgaattactct
ggggatggaaactggaaactggaactggatcttccacccgatataaaagatatagaatat
agatatttcttaagtgttaatgataagcagatctttgaggagtgggagaagaatcaccgg
attgtattggatggacaatctgattcttacatcctttatgattattggcaaatccgtccg
gataatctagccttttattcttcggctttcaccaaaagtttattcgctcatccctgcaat
acacatgagagggtcgttagaagtggaagaaaattggtgataaagatatccgctccccgg
gtggaaaagaatcagtgtgtagccattactggaaatcaagaatgcttaggtaactggcat
ccggacaaggctttattgctgagttgcgatactttcccggaatggcatattgatttagac
gctgcggagatacggtatcctttagaatataaatttttggtttgggataatgattcccgt
caacctttgtattgggagagtgatgagaatcgtattctaagtcttgttccccagaaacag
ggtgagaccgttgttatatctggtctttacttccgggatagcttaccgttatggcgttgt
gccggctcggttatccccgtcttttccttgcgctcggaaaagagctttggagtaggtgat
ttgggagatttacacatgttggtggattgggctagaaagacgcaccaacgtatcattcaa
gtattacctatgaatgatacgacaatgacccatacttgggtggattcctatccgtatagc
gctatttctatttatgcccttcatcccatgtatgtggatttatcggctttggggaccttg
aaagatccggagagagcagctttttatgcagggaagcaaaaagaattaaacgcaaaagat
acggttgattacgaggaagtactgaaatataaattgggttattgtcaagaatatttcgca
ggggagggtaaggccgtattagatacgccggagtttaaagagttcttggcgcaaaatgag
tcatggttgatgccttacgctacttattgtttcttgcgggaaagttatgggacatcggat
ttctctcaatggcaaggtaattctacttacaataagacacgtgttcgcgccctatgccgg
gaagatagtgacgcatggccggagatctcgttctcttatttcttgcaatatgtattgcac
aaccagttcaagtcggtatcggattatgcccgtaagaatggagttgtattgaaaggtgat
ttacccattggcgtgagccgcactagtgtagaggcttggacggaaccgaaatattttaat
atgaatggtcaagcgggtgctccccccgatgacttttccatgaacggtcagaactggctg
ttcccgacttataactgggatgcgatggagaaagataatttctcttggtggaaaaaacgc
ttcgctaagttaagtgattatttcgattgtttccgtatagatcacatcttgggatttttc
cgaatatgggaggttccttgtgaatatgtgcaagggctttgtggtcatttcaatccagcg
ttgccgttctcgagagaagagatcgagcagtatggattgaattttaacgaatctcgtttc
acgaccccacatatcaatcgacaatttttatcggaattgtttgaggaaaatacagaagag
gtgataggtgcttatttggcacaatcctcctcccggcattatgtgttaaaaccgttctgt
gatacgcaaaggaagattgaggcgttgtttgcggataaggcggatccagtttccctacgg
atcaagaatggcctgtttacgattgcgaatgaggtattatttcttcgtgatccaagagag
accgataagtttcatccccggatctcggcgaatcaatcctatatctatcgggaattgagt
ggttccgaccgttatgcgttcgatcagttatactggcatttcttctatcatcgccataat
gatttttggaaggcgcaagcgtttaagcgtttgacaccgttggttgcgtccacggagatg
ttggtttgtggagaggatctcggtatgatccccgcctctgttcccgaggttatgaataag
ttgcaaatactaagcttggagattgagcgtatgccgaagagcccacagcgggaattttcc
gatatgttcaatctgccttatcattcggtttgtacgacttctacacatgatatgactcct
cttcgtaattggtggaaagaagatccggagaagacacagcgttattacaaccatgtattg
caacggatcggtgaggccccggatgaatgtacggctgaaatcgttgcccagattatttct
aatcatttgaagactcgttccatgctgacgattattccgttgcaggattggtttgctatg
gatgattctatcaagcggaaggatatagaatccgagcgtattaacgttcctgcgaattca
acgcattattggcgctaccggatgcatattacgttggaacagcttttgcaggctgataac
ctgaataataagatcgtctcgttgataaaagaggctggacgaaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system