KEGG   Parabacteroides distasonis: BDI_0050Help
Entry
BDI_0050          CDS       T00549                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
pdi  Parabacteroides distasonis
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pdi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BDI_0050
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BDI_0050
Enzymes [BR:pdi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BDI_0050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(48324..50039)
Genome map
AA seq 571 aa AA seqDB search
MKRITLAWALTLCSFITFIACSSPDVGERSVSIIPAPAQMTVGEGTFTIHPGIEIGYADE
SLKGMGELLSNEIEKLSGIKLASASDKESNCIIFLELTDPKEFADLPKAYGLSPKDSVPV
DESYSLSIQKRNIYIKATTLEGIYRGITTLKQIVGGNLQPGGEKIYLPLLEVKDSPRFAW
RGLSFDVSRCFFDPEEVKQVIDMIALYKMNVLHMHLSDNQGWRIEIKKYPELAEIGGQLP
NNGRKGGYYTQEEFKDLVNYAKERFITIIPEVDIPGHTAAIFAAYPDFKNAVKFKTNVNI
PGQAFNALDVDDPKAMQFTEDVIAELAALAPGNYIHIGGDEAIGLPHDKFVRFINKTREI
VLKNGKKMVGWQETARADISEGDVIQHWIYLKQKNEDSSKKKDNIPAEYKEIMALFAEFM
KEAPKDPGLGISKKAKVILSPSGYVYLDHKYLEPSADSTQNAEQERLGMAAYEKQTIQEM
YDWDPMTFNPTVENPQKDVAGIEAAIWCETITNFRDLQFLLMPRLAGVAEKGWSKVENTH
WDEYKVRLGAQAPLWEKADWNYFKSSLVDWK
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaatcactctcgcatgggcattgaccctctgtagttttattacatttatcgcc
tgttcatccccagatgttggagaaagaagcgtaagcattatccccgctccggcccaaatg
acagtaggcgaaggtacattcacgatccatcccggcatcgagatcggttatgcggacgaa
tccttaaagggtatgggcgagttgctatccaacgagatagaaaagctatccggcatcaag
ctggcttccgcctcagacaaagaatcgaattgcatcatcttcctcgagttgacagatccg
aaagagttcgccgacctgccaaaagcttatggattgagtccgaaagatagtgtccccgta
gatgagtcttactccctctccatccaaaagagaaacatctacatcaaggccactacccta
gaaggtatctatcgaggtatcactaccttgaaacaaatcgtgggtggtaatctacaaccc
ggaggcgagaagatttatctaccgctactggaagtgaaggactcacctcgtttcgcttgg
cgtgggctttctttcgatgtatctcgttgcttcttcgatcccgaggaagtgaaacaagtg
atcgatatgatcgccttatataagatgaacgtactgcatatgcatctttccgataaccaa
ggctggcgtatcgagatcaagaaatatcccgagctagcggaaataggaggtcaacttccc
aacaacgggagaaaaggaggctattatacgcaagaggaattcaaggatctcgttaattac
gcaaaagaacgcttcatcacgatcatcccggaagtagatatcccggggcatacagctgcc
atattcgccgcttatccggactttaagaacgctgtcaaattcaagaccaatgttaacatc
ccgggacaggccttcaatgccctcgacgtagatgatccgaaagcgatgcaatttacggag
gatgttatcgcggagctagccgctttagcacccggaaactacattcatatcggaggtgac
gaggcgatcggcttaccccatgataagttcgtccgttttataaataagacacgggaaatc
gtattgaagaatggaaagaaaatggtcggctggcaagaaaccgcccgtgcggatatctcg
gaaggcgatgtcatccagcactggatttatctgaagcaaaaaaacgaggactcttctaag
aaaaaagataatatacctgccgaatataaagagatcatggccttattcgccgaattcatg
aaagaggcaccaaaagatccgggtcttggtatatccaaaaaagcgaaagtgattctctcg
ccgagcggttacgtttatctggaccataaatatctggaaccaagtgcggactccacccaa
aacgcggagcaagaacgtttaggtatggccgcctacgagaaacaaacgatccaagaaatg
tacgactgggacccgatgaccttcaacccgactgtagagaatcctcaaaaagatgtagcg
ggtatagaagccgctatctggtgcgagacgatcaccaatttcagagatctgcaattcctg
ttaatgcctcgtttggcaggtgtcgccgaaaaaggttggtccaaagtagagaacacacat
tgggacgaatataaagtaagacttggtgcgcaagcccccttatgggaaaaggccgattgg
aactattttaaatcatccttagtggattggaaataa

DBGET integrated database retrieval system