KEGG   Parabacteroides distasonis: BDI_0074Help
Entry
BDI_0074          CDS       T00549                                 

Definition
outer membrane phospholipase A
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
pdi  Parabacteroides distasonis
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pdi00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BDI_0074
   00565 Ether lipid metabolism
    BDI_0074
   00590 Arachidonic acid metabolism
    BDI_0074
   00591 Linoleic acid metabolism
    BDI_0074
   00592 alpha-Linolenic acid metabolism
    BDI_0074
Enzymes [BR:pdi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     BDI_0074
    3.1.1.32  phospholipase A1
     BDI_0074
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
79048..79881
Genome map
AA seq 277 aa AA seqDB search
MKKTIISFLFLFVCGMAHSQVLAKGPEESYNADSIRAILDKSPYFTLFKDNYFIGGIPIG
NKPTARNSDVKFQLSIAQRLTKSKLPFDTYLFLQYTQKAFWNVFQESLPMRDLNFNPGIG
LGHLIVHKNKYIGKGYLMVEHESNGKDSIFSRSWNKITLAAAVLLNKNWEVQFKGWIPIV
DGKENKDILKYNGIFQVAANYRTDNRRFNCGVILTKRKTWFSFNTQIELSYKFNNNENQY
FFLQYYNGYGENLLEYNQYKSMLRIGFVIKPQDFSIY
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaacgattatatcctttctcttcctttttgtttgcggtatggcacattcgcaa
gttttagcgaaagggccggaagagagttataacgcggatagtattcgtgcgattttggat
aagtcaccttattttaccttattcaaggacaattattttattggcggtatccctatcggc
aacaagcctacggcgagaaactccgacgttaaattccagttgagcatcgcccaacgtctt
acgaaaagtaaactccccttcgatacctatcttttcttgcaatacacgcaaaaggctttt
tggaatgtctttcaagagtccttgccgatgcgcgacttgaattttaatccgggtatcggt
ttggggcaccttatcgtgcataagaataaatatatcgggaaaggctatttgatggtcgag
cacgagtcgaacggtaaagatagcatcttctcccgaagttggaacaagatcaccctagcg
gcggctgtcctgttgaataagaactgggaagttcaattcaagggctggataccgatcgtg
gatggcaaggaaaataaagacatccttaaatataatggtatattccaagtagccgccaat
taccggacagacaacaggcgctttaactgcggggttatcttgaccaaacgaaagacttgg
ttcagctttaacactcagatcgagttgagctataagtttaataataacgagaaccaatat
ttcttcctgcaatattataatggttacggtgagaaccttttggaatacaatcaatacaaa
agcatgctgcggatcggtttcgtgatcaagccgcaagatttcagtatttactaa

DBGET integrated database retrieval system