KEGG   Parabacteroides distasonis: BDI_0089Help
Entry
BDI_0089          CDS       T00549                                 

Definition
alpha-glycosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
pdi  Parabacteroides distasonis
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:pdi00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BDI_0089
  Lipid metabolism
   00561 Glycerolipid metabolism
    BDI_0089
   00600 Sphingolipid metabolism
    BDI_0089
Enzymes [BR:pdi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     BDI_0089
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(97496..99694)
Genome map
AA seq 732 aa AA seqDB search
MKNLLLTVILLCFCLPFVKAADQKMILISTNETDLILQVAPNGRLYQTYLGNKLVNESEF
ENLSWNIQAGTDGSVSTRGWEVYPCSGAEDYFEPAFAIQHNDGNMTSIFKYVSSESKKLD
NNVTETIISLKDDVYPVEAKLHYVTFAKENVIKAWTEIRHMEKKPVTITQYASNMLYFES
PRYVLTEFSGDWAKEVQMSSQDLKFGKKIIDTKLGSRAAMHAYPFFEIGLGAPASENTGD
VLMGTIGWTGNYRFTFEVDNAGNLRVISGINPYASAYELKPNEWFVTPEFIFTLSNQGTG
KASRDIHDWARNYQIKDGKGDRLTLLNNWESTGFNFNEKKLEELMKEAKHLGVDMFLLDD
GWFANKYPRQNDKAGLGDWEVTHDKLPNGIPHLVQTAKDAGVKFGIWIEPEMVNPKSELF
EKHPDWAIHLPNRETYYYRNQLVLDLSNPKVQDYVFSVVDNIMIENPDLAFFKWDCNSPI
TNVYSPYLKEKQNQLYIDHVRGVYNVFKRVAEKYPHLPIMLCSGGGARCDYEALKYFTEF
WCSDNTDPIERLYIQWGFSQFFPAKAMCAHVTSWNKNTSIKFRTDVAMMCKMGFDISLKE
MNDDEMKYCQEAVANYKRLKGTILDGDLYRLVSPYDTNHSSVMYVDKAKSKSVLFAYDIH
PRFGEKTFPVKLQGLDPNKKYKVQEINLMPGQKSTLVTDGGTFSGDFLMKIGMNVFSTAH
AHSKVIELTEAH
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatctattacttacagttatccttttgtgcttttgtttgccattcgtaaaagcc
gccgatcaaaagatgatcttaatctcgaccaacgagacggacttgattttacaagtagcc
cccaacggacggctctaccaaacttatctgggaaataaattagtaaacgaatccgaattt
gagaacctctcatggaatatccaagccggaacggatggcagcgtatcaacccgtggatgg
gaagtatatccttgctcaggagcggaagattatttcgaaccggctttcgccatccagcat
aacgacggaaacatgactagcatattcaagtatgtttccagcgaatctaagaaactagac
aataacgttacggagacaattatctccctgaaagacgatgtatacccagtggaggctaaa
ttacattatgtaaccttcgctaaagaaaacgtgatcaaggcttggactgagattcgtcat
atggagaaaaaaccggtcacgattacccaatacgcttccaatatgctttatttcgagagt
cctcgctatgtattgaccgagtttagcggtgactgggccaaggaagtacagatgagcagc
caagacttgaaattcgggaaaaagattatcgatacgaaactaggctcccgtgccgctatg
cacgcttacccgttttttgagattggattaggtgccccggccagtgagaatacaggagat
gttttaatgggaacgatcggttggactggaaactaccgctttacgttcgaggtggacaac
gccggtaaccttcgtgtcatctccggcatcaatccctatgcgtccgcctatgaattgaaa
ccgaacgaatggttcgtcactcctgagtttatctttacattgagtaatcaaggaaccgga
aaagccagtcgtgatatccatgattgggcacgtaattaccagatcaaggatggtaaaggc
gatcgccttaccctactgaacaactgggaatcgaccggtttcaatttcaacgagaagaaa
ttggaggaattaatgaaagaagccaagcacctaggtgtagatatgttcttgctggacgat
ggttggttcgctaataaataccctcgtcaaaacgataaggccggattgggcgattgggag
gttacacacgataagttgccgaacggcattcctcatctggtgcagaccgctaaagatgcc
ggcgtgaaattcggtatctggatcgagccggagatggtaaaccccaagagcgaacttttc
gagaaacacccggattgggcgatccatctaccgaatcgtgagacttattactaccgcaat
caacttgtcttggacttaagtaacccgaaagtacaggattatgtattcagcgtggtggat
aatatcatgatcgagaatccggatctggctttcttcaaatgggattgcaacagcccgatt
accaatgtctattccccctatcttaaagagaagcagaatcaattgtatatcgaccatgta
cgaggtgtctataacgtattcaaacgggtagccgagaaataccctcacctaccgatcatg
ctttgctccggtgggggtgcccgctgtgattacgaggcattgaaatatttcacggaattc
tggtgcagcgacaacaccgatccgatcgagcgtttgtatatccaatggggattctcccag
ttcttcccggcaaaggcaatgtgcgcccacgtgactagctggaacaagaatacctccatc
aagttccgtaccgacgtggccatgatgtgtaagatgggcttcgatatcagcttgaaggaa
atgaacgatgacgagatgaaatactgccaagaagcagttgccaactacaaacgtctaaag
ggcacgatcctcgacggcgatctgtaccgtctagtctccccttacgataccaaccattca
tccgtgatgtacgtggataaggcaaaaagcaaatccgtcctattcgcttatgatatccac
cctcgcttcggagaaaagactttccccgtaaagctacaaggattggacccgaataagaaa
tataaggtacaagagataaacctcatgccgggccagaaatcgaccttggttaccgacgga
ggtaccttcagcggagatttcttgatgaaaataggaatgaacgtgttctctacggctcat
gcccatagcaaggtcatagagctgaccgaggctcactaa

DBGET integrated database retrieval system