KEGG   Parabacteroides distasonis: BDI_0230Help
Entry
BDI_0230          CDS       T00549                                 

Definition
beta-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
pdi  Parabacteroides distasonis
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pdi00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BDI_0230
  Lipid metabolism
   00600 Sphingolipid metabolism
    BDI_0230
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BDI_0230
Enzymes [BR:pdi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     BDI_0230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(240227..243565)
Genome map
AA seq 1112 aa AA seqDB search
MNSIKKMMLSGALGCLISGMAYADGSSPQPVKPYWQDIQVVAVNKEKPRSSFMSYADRET
ALTSRFEKSPYYFLLNGTWKFFFVDSYKDLPQNITDPSVNTSSWDDITVPGNWEVQGHGV
AIYTNHGYEFKPRNPQPPLLPEANPVGVYRRDIEIPASWDNRDIYLHIGGAKSGLYVYLN
GKEVGYSEDSKNPAEFLINKYLQPGKNVLTLKIFRWSTGSYLECQDFWRMSGIERDVFLW
SQPKASIQDFRVVSTLDDTYTNGIFKLAVDLKNHTQETKNLNVGYELLDAKGNLVTSEAN
DIWVSPASPQTVSFEYDLKNVAPWSAEHPNLYKLLMTIKEEGKVIEVVPFNVGFRRFEMK
QIDQVAEDGKPYTVLLFNGQPVKFKGVNIHEHNPETGHYVTEELMRKDFELMKQNNINAV
RLCHYPQDRKFYELCDEYGLYVYDEANIESHGMYYSLKKGGTLGNNPEWLIPHMDRTMNM
YERNKNYPSVTFWSLGNEAGNGYNFYQTYLYLKDKEINSMNRPVNYERALWEWNTDMYVP
QYPSAEWLEEIGRKGSDRPVAPSEYSHAMGNSSGNLWDQWKAIYKYPNLQGGFIWDWVDQ
GILEKDKNGREYYTYGGDYGVNAPSDGNFLCNGIVNPDRTPHPAMAEVKYAHQNIGFEAI
DLANGLFRVTNRFYFTNLKKYMVHYSVTANNKVVRSGKVSLDIEPQASKEFTVPVGNLKP
QAGTEYFVNFNVTTVEKEPLIPIGHEIACDQFRLPIESPKKAFKTSGPKLTVSTNGDNLS
ASSSKVNFVFNRKTGIVTSYKVDGTEYFSEGFGIQPNFWRAPTDNDYGNGMPKRLQVWKE
SSKNFNVTDATVTMDGNNAVVSVNYLLPAGNLYIVNYTIYPSGAVNVAARFTSTDMDAAQ
TEVSEATRTATFTPGRDAARKEASKLNVPRIGVRFRLPASMNQVEYFGRGPAENYLDRNA
GSMVGLYKSTAEELYFPYVRPQENGHHTDTRWVSLSTGKKGLLIQADNTIGFNALRNSIE
DFDDEEATGLPRQWSNFTPEQVANHDEAAAKNVLRRQHHINNITPRDFVEVCVDLKQQGV
AGYDSWGSRPEPAYTLPANREYNWGFTLIPLK
NT seq 3339 nt NT seq  +upstreamnt  +downstreamnt
atgaactctatcaaaaaaatgatgctttccggagcattaggttgccttatttccggaatg
gcttatgcggacggttcttcaccccaacccgtaaaaccttattggcaagacattcaagtc
gtagccgtaaacaaggaaaaacccagaagctccttcatgagttatgcggaccgagaaacc
gccctcacctctcgatttgagaaaagcccgtactatttcctattaaacggtacttggaaa
tttttctttgtcgactcttacaaagatcttcctcaaaatatcacagatccttccgttaat
acctcttcatgggatgatataaccgttcccggaaactgggaagtacaaggacatggcgta
gccatttatacgaatcatggttacgagtttaaaccaagaaatccccaacctccgttattg
ccggaagcgaatccggttggcgtataccgcagagacatcgagatacccgcaagttgggat
aaccgggatatttatttacacatcggcggagctaaatccggcctttacgtatatttaaac
gggaaagaagtgggttatagcgaggattccaaaaatcccgccgagttcctgatcaataaa
tacctgcaacccggaaagaatgtgcttacattaaagatattccgttggagcaccggttct
tatttggaatgtcaggatttctggagaatgagcggtatcgaacgtgacgtattcctttgg
tctcaacccaaggccagtattcaagatttccgtgtcgtctcaaccttggacgatacgtat
acgaatggaatcttcaaactggcggtagacttaaagaatcatacccaagaaacgaaaaat
ttaaatgtcggatatgagcttttggacgcaaaaggtaatcttgtgacctccgaggctaat
gatatatgggtaagtcctgcaagtcctcaaacagtatctttcgagtatgatttaaagaac
gtagccccttggagtgccgagcatccgaatctatacaaattattgatgacgataaaagaa
gagggtaaggtaatcgaggtagttccattcaacgttggtttccgccggttcgagatgaag
caaattgaccaagtagcggaagacggaaaaccttatacggtcttattgttcaatgggcaa
ccggttaagttcaagggtgtcaatattcatgagcataacccggaaaccggacattacgta
accgaggaactcatgcgtaaggatttcgagctgatgaagcaaaacaatatcaacgctgtc
cgcctatgccactatccgcaagaccgtaaattctatgaactctgcgacgaatacggattg
tatgtttacgatgaagcgaatatcgagtctcacggtatgtattacagcctgaaaaaaggc
ggcactttgggtaataatccggaatggctgatcccgcatatggaccgtacgatgaatatg
tacgaacgaaacaagaattatccgagcgttactttctggtcactcggaaacgaggctgga
aacggatacaacttctatcaaacttatttatatctgaaagacaaggaaataaatagcatg
aatcgtccggtgaactatgaacgtgccctttgggaatggaatacggatatgtacgtacct
caatacccgagcgctgaatggctagaggaaatcgggcgtaagggtagtgatcgtccggta
gctccttcggagtattcacatgcgatgggaaactcttccggcaacttatgggatcaatgg
aaagctatctataaatacccgaacctgcaaggcggattcatctgggactgggtggaccaa
ggtatcttggaaaaagataagaatggacgtgaatattatacctatggtggtgactatgga
gtaaacgcccctagtgacggaaacttcctttgcaacggtatagtaaacccggatcgtacc
ccgcatcccgctatggcagaggttaaatacgcccatcaaaatatcgggtttgaggcgatc
gatttagcgaacggtttattccgcgtcacgaaccgtttttatttcacgaacctaaagaaa
tatatggtccactatagcgtaacagccaataataaagttgtacgctccggtaaagtctct
ttggacatagaaccccaagcttctaaggaatttacggttcccgtaggcaacttaaagcca
caagccggtacggaatatttcgtaaacttcaacgtaacgaccgtagaaaaagagccgtta
atccctatcggacacgaaatcgcttgcgatcaattccgcttaccgatcgaaagccccaag
aaggcgtttaagaccagcggccctaaattaacggtttcgacaaatggagataacttatcg
gcatcctcctcaaaggtaaacttcgtgtttaacaggaagacaggaatcgttacttcttat
aaagtggatggtacggaatatttcagcgagggtttcggtatccaaccgaacttctggcgt
gcgccgaccgataacgattacggaaacggtatgccaaaacgcttgcaagtctggaaggaa
agcagcaagaacttcaacgtgacagacgctaccgtcactatggatggcaataacgccgtg
gttagcgtgaactatttattgccggcaggaaatctatacattgttaattatacgatctat
ccaagcggagccgtaaatgtggccgcccgtttcacatccacggatatggatgccgcccaa
accgaggtatcggaagctactcgcacggcaactttcactccgggacgtgacgccgcccgt
aaagaggcttccaaattgaatgttccccgtatcggtgttcgcttccgcttaccggcaagc
atgaatcaagtggaatatttcggacgaggacctgctgagaactacttggatagaaacgcc
ggtagtatggtcggcttatataaatctacagccgaggaattatatttcccatatgtacgc
ccgcaggaaaacggtcatcataccgacactcgttgggtatcacttagtaccggcaagaaa
ggcttgttgatccaagcggataatacgattggatttaacgctttgcgtaattccatagag
gatttcgatgacgaggaagcaactgggctaccccgtcaatggagtaatttcacaccagag
caagtagcgaaccatgatgaagccgcagcaaagaacgtattacgtcgccagcatcatatc
aacaatatcacgcctcgcgacttcgttgaagtttgcgtcgacttgaaacaacaaggtgta
gcaggttatgatagctggggttcacgtccggaaccagcttatacattacccgcaaaccgg
gaatacaactggggctttacccttattccgcttaaataa

DBGET integrated database retrieval system