KEGG   Parabacteroides distasonis: BDI_0430Help
Entry
BDI_0430          CDS       T00549                                 

Definition
1-aminocyclopropane-1-carboxylate deaminase
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
pdi  Parabacteroides distasonis
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:pdi00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BDI_0430
Enzymes [BR:pdi01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     BDI_0430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
495410..496345
Genome map
AA seq 311 aa AA seqDB search
MTPLYFLFSDSNKNNIYIKRDDLIPISFGGNKARKAMNFFKEIDQGGFDCVVTYGSGSSN
HCRIVSNMAASRKLPCYIVAPKESSLPTFNSKMMELFGSHFMITPVNEVHDTIERLLATL
KEEGKKPYFIAGGGHGNLGTQAYVDCYKEIAVYEHECKIHFGLIFLASGTGTTQAGLVCG
QLMSQDKRKIIGISIARKNPRGKQVVLDSSYEYLASKGIYLSKIQLESEIVFVDDYVGLG
YGTKSKDIDYTINSVLVNFGIPMDSTYTAKAYTGMIRYIQENNVTGENILFIHTGGTPLF
FDDLMRLENII
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgactcctttatactttttgtttagtgattccaataaaaataatatctatataaaacgt
gatgatctgatccctatctcttttggtgggaataaggcaagaaaagccatgaacttcttt
aaagaaatagatcaagggggatttgattgtgtagttacgtatggaagtggtagctccaac
cattgccgaatcgtttcaaatatggcagcttcaaggaaattgccttgttatattgtcgct
ccaaaagaatcttctttgcctacattcaatagtaagatgatggagttattcggctctcat
tttatgattactcctgtcaatgaggtccatgacaccatcgagagattgttggctacattg
aaagaggaaggaaagaagccttattttattgcgggtggcgggcatggtaatctaggaacg
caggcttatgtggattgctataaggaaatcgcagtatatgagcatgagtgtaaaattcat
tttggtcttatctttctagcgtcaggtacgggtacaacgcaagcaggattggtttgcgga
caattgatgagtcaagataaacgaaagattataggtattagtatcgctcggaaaaatcct
cggggaaaacaagtggtattggatagctcgtatgaatatttagcgagtaaagggatatat
ctatcaaagatccaattagaaagtgaaatagtttttgttgatgattatgtcggtttagga
tatggaacaaaatccaaggatatagattatacgattaatagcgtcttagtgaattttgga
ataccaatggactctacttatacagcgaaagcatataccggaatgataagatatatacaa
gaaaataatgtgacaggagaaaatatcctatttattcatacgggtggaacccctttattt
tttgatgatttgatgagattagaaaatataatttag

DBGET integrated database retrieval system