KEGG   Parabacteroides distasonis: BDI_0480Help
Entry
BDI_0480          CDS       T00549                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
pdi  Parabacteroides distasonis
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pdi00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BDI_0480
Enzymes [BR:pdi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     BDI_0480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
553122..554273
Genome map
AA seq 383 aa AA seqDB search
MKKRQLAILGSTGSIGTQALEVVSEHSDLFEVYALTANNQVDLLINQARKYMPEVVVIAN
ERKYPELKEALEDLPIKVWAGADAIAQMVQSEPIDMVLTAMVGYSGLRPTISAIKAGKAI
ALANKETLVVAGELIMKLAAEHKVPILPVDSEHSAIFQCLTGAYDNPIEKILLTASGGPF
RRKTLEELATVTKAQALRHPNWTMGAKITIDSASMMNKGFEMIEAKWLFDVTPDQVQVVV
HPQSVIHSMVQFEDGAVIAQLGIPDMKLPIAYAFSFPTRMRSMAPRLDFNQYSTLTFEEP
DMERFRNLAFAFEAARQGGNMPCILNAANEVVVAAFLQDRIGFLQMSDVIERTMRKASFI
VNPSYEDYVATDTEARRLAAELF
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaagacagttagcgatattaggctcgaccggttccatcggaacccaagccttg
gaggtagtgagcgagcattccgatcttttcgaggtgtatgccttgaccgcgaataaccaa
gtggacttattgatcaatcaggcccggaaatatatgccggaggtggtggtgatcgccaac
gagcggaaatatcccgagctgaaagaggccttggaggacttgccgatcaaggtatgggcg
ggtgccgacgctatcgcccagatggtgcagtcggagccgatcgatatggtgctgacggcg
atggtgggttattccggcttgcgaccgacgatctcggcgatcaaggcgggaaaggcgatc
gccttggcgaataaggaaactttggtcgtggccggcgagctgatcatgaagctggccgcc
gagcataaggtgcctatcttgccggtggactcggaacattcggccatttttcaatgttta
acaggtgcgtacgataatccgatcgagaagatcttgctgacggcttccggcggtccgttc
cggcggaagacgctggaggagctggctaccgtgacgaaggcgcaggccttgaggcatccg
aactggacgatgggggcgaagatcacgatagactcggcctcgatgatgaacaagggcttc
gagatgatcgaggcgaaatggttgttcgatgtcacgccggatcaggtacaggtggtggtg
cacccacagtcggtgatccactcgatggtgcagtttgaggatggcgccgtgatcgcccag
ctgggaattcccgacatgaaattgccgatcgcctacgctttctcgtttccgacacgtatg
aggagcatggcgccccgtctggattttaaccaatattcgactttgacgttcgaggagccg
gatatggaacgtttccgcaacttggctttcgctttcgaggcggcccgccaaggagggaat
atgccctgtatcttgaatgccgccaatgaggtggtggtggctgccttcctgcaagatcgt
atcggcttcttgcaaatgagcgacgtgatcgagcggactatgcggaaagcctcgtttatc
gtcaatccctcgtatgaggattacgtggctaccgacaccgaggctaggcggttggcggcc
gagttattttga

DBGET integrated database retrieval system