KEGG   Parabacteroides distasonis: BDI_0586Help
Entry
BDI_0586          CDS       T00549                                 

Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pdi  Parabacteroides distasonis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pdi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BDI_0586
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BDI_0586
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BDI_0586
Enzymes [BR:pdi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BDI_0586
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(686715..687488)
Genome map
AA seq 257 aa AA seqDB search
MNRITNLFQTQKDGILSVYFTAGYPNLNDTASILKALQAKGIHMVEVGIPFSDPMADGPV
IQEAATQALRNGMSLHLLFGQLREIRSEVQIPIILMGYLNPIMQYGFEKFCASCVEAGVD
GMIIPDLPYADYIADYKEIADRHDLKMIMLITPETSEERIRLIDAHTSGFIYMVSSAATT
GAQQDFNEQKQAYFRRINAMNLQNPRLVGFGISNKATFEAAIAHSSGAIIGSKFVQLLKS
EATPAEAVDKLLEALKQ
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgcatcacaaacttattccagacccagaaagacggaatactctccgtctatttc
accgccggttatccgaacttaaacgatacggcaagcatcttaaaagccttacaggctaaa
ggtatccacatggtagaagtaggaatccccttctccgacccgatggcagacggccctgtc
atccaagaggccgctacgcaagcgttgcgtaacgggatgtcactccacctcctattcggg
caattgagagagatccggagcgaagtacagatcccgatcatcctgatgggctacctgaat
cctatcatgcaatacggtttcgagaaattctgtgccagttgcgtagaggccggcgtagac
ggaatgatcatccccgacctgccttacgccgattatatcgccgactacaaggagatcgcc
gatcgccatgacctgaaaatgatcatgctgatcaccccagagacctccgaggaacgaatc
cggctgatcgatgcccataccagcggatttatctatatggtatccagcgccgccacgacc
ggagcccaacaagacttcaacgagcagaagcaggcctatttccgtcgtatcaacgccatg
aacctacagaatccccgcttggtaggtttcggtatcagcaataaagccactttcgaggcg
gcgatagcccattcttccggtgccatcatcggcagtaagttcgtacagttactaaagagc
gaagctactcccgccgaagcggtcgataagttactggaagccctaaaacaatag

DBGET integrated database retrieval system