KEGG   Parabacteroides distasonis: BDI_0586Help
Entry
BDI_0586          CDS       T00549                                 

Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pdi  Parabacteroides distasonis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pdi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BDI_0586
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BDI_0586
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BDI_0586
Enzymes [BR:pdi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BDI_0586
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(686715..687488)
Genome map
AA seq 257 aa AA seqDB search
MNRITNLFQTQKDGILSVYFTAGYPNLNDTASILKALQAKGIHMVEVGIPFSDPMADGPV
IQEAATQALRNGMSLHLLFGQLREIRSEVQIPIILMGYLNPIMQYGFEKFCASCVEAGVD
GMIIPDLPYADYIADYKEIADRHDLKMIMLITPETSEERIRLIDAHTSGFIYMVSSAATT
GAQQDFNEQKQAYFRRINAMNLQNPRLVGFGISNKATFEAAIAHSSGAIIGSKFVQLLKS
EATPAEAVDKLLEALKQ
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgcatcacaaacttattccagacccagaaagacggaatactctccgtctatttc
accgccggttatccgaacttaaacgatacggcaagcatcttaaaagccttacaggctaaa
ggtatccacatggtagaagtaggaatccccttctccgacccgatggcagacggccctgtc
atccaagaggccgctacgcaagcgttgcgtaacgggatgtcactccacctcctattcggg
caattgagagagatccggagcgaagtacagatcccgatcatcctgatgggctacctgaat
cctatcatgcaatacggtttcgagaaattctgtgccagttgcgtagaggccggcgtagac
ggaatgatcatccccgacctgccttacgccgattatatcgccgactacaaggagatcgcc
gatcgccatgacctgaaaatgatcatgctgatcaccccagagacctccgaggaacgaatc
cggctgatcgatgcccataccagcggatttatctatatggtatccagcgccgccacgacc
ggagcccaacaagacttcaacgagcagaagcaggcctatttccgtcgtatcaacgccatg
aacctacagaatccccgcttggtaggtttcggtatcagcaataaagccactttcgaggcg
gcgatagcccattcttccggtgccatcatcggcagtaagttcgtacagttactaaagagc
gaagctactcccgccgaagcggtcgataagttactggaagccctaaaacaatag

DBGET integrated database retrieval system