KEGG   Parabacteroides distasonis: BDI_0592Help
Entry
BDI_0592          CDS       T00549                                 

Definition
(GenBank) tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pdi  Parabacteroides distasonis
Pathway
pdi00260  Glycine, serine and threonine metabolism
pdi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pdi01100  Metabolic pathways
pdi01110  Biosynthesis of secondary metabolites
pdi01130  Biosynthesis of antibiotics
pdi01230  Biosynthesis of amino acids
Module
pdi_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pdi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BDI_0592
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BDI_0592
Enzymes [BR:pdi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BDI_0592
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABR42368
UniProt: A6L9K4
Position
complement(692175..693359)
Genome map
AA seq 394 aa AA seqDB search
MKTYQVDKNGYYGEFGGAYVPEILHQCVENLQNTYLQVLESDSFKEKFDQLLRDYVGRPS
PLYLAKRLSEKYGCKIYLKREDLNHTGAHKINNTIGQILLARRMGKSRIIAETGAGQHGV
ATATVCALMNMECIVYMGKTDVERQHANVQKMEMLGATVVPVTSGNMTLKDATNEAIRDW
CCHPSDTYYIIGSTVGPHPYPDMVARLQSVISEEIKKQLLEKEGRDHPDYLIACVGGGSN
AAGTIYHFVDDERVKIVLAEAGGKGIHSGMSAATIQLGKEGIIHGARTLVMQNEDGQIEE
PYSVSAGLDYPGIGPIHANLSVKHRAQILAVDDDEALEAAFELTRLEGIIPALESAHALG
ALAKVNFKPEEVVVLTVSGRGDKDMDTYINYKLS
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgtatcaagttgacaagaatggttactatggtgagttcggcggggcctatgtt
cccgagatccttcatcaatgcgtggaaaatttacagaatacctatctgcaagtgttggag
agcgatagcttcaaggaaaagttcgatcagttattgcgtgattatgtaggccgcccctcc
cctctttacttggccaaacggttgagcgagaaatacggatgtaagatctatttgaaacgg
gaagacttgaaccataccggagcacataagatcaacaatacgatcggccagatcctccta
gcccgccgcatggggaagagccgtatcatcgccgagacgggtgccggacagcatggagtg
gctacggctacggtatgtgccttgatgaatatggaatgtatcgtttatatggggaagaca
gacgtggaacgccaacatgccaacgtacagaagatggaaatgctgggagctaccgtcgtg
cccgtgacctcgggaaacatgaccttgaaagacgccacgaacgaggcgatccgtgactgg
tgctgtcatccttcggatacgtattatattatcggttctacggtaggcccccatccttat
ccggatatggtagcccggctgcaatccgttatcagcgaggagatcaagaagcaactgctg
gagaaggaaggaagggatcacccggattacctgatcgcctgcgtaggcgggggaagtaac
gccgccggtacgatctatcatttcgtggacgacgagcgggtgaagatcgtattggccgag
gccggcggcaagggcatccactccggcatgagcgccgccacgatccaattgggtaaagag
ggcatcatccacggggcacgtaccttggtcatgcagaacgaggacggacagatcgaggaa
ccttattctgtttccgccggcttggattacccgggcatcggcccgatccacgcgaacctc
tccgtaaagcaccgtgcgcaaatcctagcggttgatgatgacgaggcgttggaggccgct
ttcgagttgacccgtctggaaggaatcatcccggccttggaaagcgcccatgccttggga
gccttggccaaggtaaacttcaagccggaagaggtggtggtactgactgtctcgggccgt
ggcgataaagatatggacacttacattaattataaattatcatga

DBGET integrated database retrieval system