KEGG   Parabacteroides distasonis: BDI_0596Help
Entry
BDI_0596          CDS       T00549                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pdi  Parabacteroides distasonis
Pathway
pdi00010  Glycolysis / Gluconeogenesis
pdi00260  Glycine, serine and threonine metabolism
pdi00680  Methane metabolism
pdi01100  Metabolic pathways
pdi01110  Biosynthesis of secondary metabolites
pdi01120  Microbial metabolism in diverse environments
pdi01130  Biosynthesis of antibiotics
pdi01200  Carbon metabolism
pdi01230  Biosynthesis of amino acids
Module
pdi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pdi_M00002  Glycolysis, core module involving three-carbon compounds
pdi_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pdi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BDI_0596
  Energy metabolism
   00680 Methane metabolism
    BDI_0596
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BDI_0596
Enzymes [BR:pdi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BDI_0596
Membrane trafficking [BR:pdi04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BDI_0596
Exosome [BR:pdi04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BDI_0596
  Exosomal proteins of melanoma cells
   BDI_0596
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ABR42372
UniProt: A6L9K8
Position
complement(696988..697734)
Genome map
AA seq 248 aa AA seqDB search
MKSIVLLRHGESIWNKENRFTGWTDVDLTEKGVAEAYRAGNLLKEKGYVFNKAYTSYLKR
AVKTLNCVLDRMDQDWIPVEKSWRLNEKHYGSLQGLNKSETAQKYGDEQVLIWRRSYDIA
PLPLSEDDPRNPRFDIRYKDVPDKELPRTESLKDTVERILPYWKEVIFPTLRTADQILVA
AHGNSLRGIIKYLKNISDEEIVHLNLPTAVPYVFEFDDDLKLVNDYFLGDPEEIKKLMEA
VANQGKKK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtatcgtattgcttcgccacggcgaaagtatatggaataaagagaaccggttc
accggttggaccgatgtggatttgacagaaaaaggcgtggccgaagcttatagggccggc
aacctattgaaagaaaaaggatatgtgttcaataaagcctatacctcttatttaaaacgg
gccgtcaaaaccttgaattgtgtattggatcgcatggaccaagactggatcccggtggag
aagagctggaggctgaacgagaaacattacggatcgctacaagggttgaacaagagcgag
accgcccaaaagtatggagacgagcaggtcttgatctggcgtcgcagttacgatatagcc
ccgcttcccctatcggaagacgaccctcgtaaccctcgcttcgatatccgctacaaagac
gtgccggataaagagttgccccgtacggaatccttgaaagatacggttgagcggattctc
ccttattggaaagaggttatcttcccgacgctccggaccgccgaccagatccttgtcgcc
gctcacggaaacagcttgcggggaatcatcaaatatttaaaaaacatctccgatgaagag
atcgttcatctgaatctcccaacagccgttccatacgtgttcgagttcgatgatgactta
aaactcgtgaatgattatttccttggcgacccggaggaaatcaagaaactcatggaagcc
gtagccaaccaaggaaagaaaaagtag

DBGET integrated database retrieval system