KEGG   Parabacteroides distasonis: BDI_0596Help
Entry
BDI_0596          CDS       T00549                                 

Gene name
gpmA
Definition
phosphoglyceromutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pdi  Parabacteroides distasonis
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pdi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BDI_0596 (gpmA)
   01230 Biosynthesis of amino acids
    BDI_0596 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BDI_0596 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    BDI_0596 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BDI_0596 (gpmA)
Enzymes [BR:pdi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BDI_0596 (gpmA)
Exosome [BR:pdi04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BDI_0596 (gpmA)
  Exosomal proteins of melanoma cells
   BDI_0596 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(696988..697734)
Genome map
AA seq 248 aa AA seqDB search
MKSIVLLRHGESIWNKENRFTGWTDVDLTEKGVAEAYRAGNLLKEKGYVFNKAYTSYLKR
AVKTLNCVLDRMDQDWIPVEKSWRLNEKHYGSLQGLNKSETAQKYGDEQVLIWRRSYDIA
PLPLSEDDPRNPRFDIRYKDVPDKELPRTESLKDTVERILPYWKEVIFPTLRTADQILVA
AHGNSLRGIIKYLKNISDEEIVHLNLPTAVPYVFEFDDDLKLVNDYFLGDPEEIKKLMEA
VANQGKKK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtatcgtattgcttcgccacggcgaaagtatatggaataaagagaaccggttc
accggttggaccgatgtggatttgacagaaaaaggcgtggccgaagcttatagggccggc
aacctattgaaagaaaaaggatatgtgttcaataaagcctatacctcttatttaaaacgg
gccgtcaaaaccttgaattgtgtattggatcgcatggaccaagactggatcccggtggag
aagagctggaggctgaacgagaaacattacggatcgctacaagggttgaacaagagcgag
accgcccaaaagtatggagacgagcaggtcttgatctggcgtcgcagttacgatatagcc
ccgcttcccctatcggaagacgaccctcgtaaccctcgcttcgatatccgctacaaagac
gtgccggataaagagttgccccgtacggaatccttgaaagatacggttgagcggattctc
ccttattggaaagaggttatcttcccgacgctccggaccgccgaccagatccttgtcgcc
gctcacggaaacagcttgcggggaatcatcaaatatttaaaaaacatctccgatgaagag
atcgttcatctgaatctcccaacagccgttccatacgtgttcgagttcgatgatgactta
aaactcgtgaatgattatttccttggcgacccggaggaaatcaagaaactcatggaagcc
gtagccaaccaaggaaagaaaaagtag

DBGET integrated database retrieval system