KEGG   Parabacteroides distasonis: BDI_0665Help
Entry
BDI_0665          CDS       T00549                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
pdi  Parabacteroides distasonis
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pdi00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:pdi00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
788928..791105
Genome map
AA seq 725 aa AA seqDB search
MTLPKRSCMKVTGLALACSSLLFSCAPKEVPQVNLIPKPAHIEVTGGYFKVDSNLIFGND
QSGTIRYVVDESFNGGNPEGYALDVTEKGIELRAASKSGLFYGEQTLRQLYTSKGIPCVS
IQDNPRFPYRGLHLDVSRHFFPKEEVMKLLNVMSYYKLNTLHMHLTDAGGWRIQMDKYPK
LTTDVAFRTESDWQKWWDGKDRKYLPEGTPGAYGGYFTKEDIREIVDYATARHINIIPEI
EFPGHSDEVFVAYPELSCAGKPYTTGDFCIGNEKSFTFMEDVLSEVIELFPSEYIHIGGD
EAGKGAWKTCPKCQGLMRRNGMKDVDELQSYMIHRAEEFLISKGRKLIGWDEILEGGLAP
EATVMSWRGEEGGIKSARMGHNVVMTPGGYMYFDFYQADPKTQPYAIGGYTPIKRAYSYN
PVPMDSLTAEESKHILGVQANTWTEYIKDEKHLEYMMFPRALAVAEIGWTPQEDRSWEDF
KPRMNANIPVLQRMGIHTFTLSDEIETTMEVDTLRREIKVMLDAEKYPAEIRYTTDGSIP
TASSRVYNGPIVVKDSADIKAAIFRDGQLQGTPTEKKVDYHRGINKPIHYNSKLYSGYMA
GGMNALLDGYRGGLTYLDGRWQGYLNDLDCVVDMGEVTDIHKVSSRFMQLIGPGVYQPGE
VELLTSEDGESYISQGVIPTTISNTDKDLSFQEYTFNGDWKARYIRIKAKEANKGFIFTD
EIVIW
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgacgttgccaaaacggtcttgcatgaaagtaaccggacttgctctcgcttgttcctca
ctacttttttcctgtgctcccaaggaggttccgcaggtgaatttaatccctaagccggcc
catatcgaggtgactggcggttatttcaaagtagatagtaatctcatattcgggaatgat
caatcgggtacgatccgttacgtggtcgatgagtcttttaatggcgggaatccggaagga
tatgcgttggacgtgaccgagaaggggattgagttgagagccgcctctaaatccggattg
ttttacggggaacaaacgttgcgccagctgtatacgtcgaaagggattccttgcgtatcg
atccaagataatccccgtttcccgtatcgtggcttgcatctggatgtctcccgtcatttc
ttcccgaaagaggaggtgatgaagttattgaacgtcatgtcttattataaattgaatacg
cttcatatgcatttgacggatgccggtggttggcgtatccagatggataaatacccgaaa
ctgactacggacgtggctttccgtacggaatccgattggcagaaatggtgggatggaaag
gatcgcaagtatctgccggaaggaactccgggggcatatggcggttattttacgaaagaa
gatatccgtgagatcgtggattacgctacggcccggcatattaatataataccggaaatc
gaattcccggggcattcggacgaggtgttcgtggcgtacccggagttgagttgtgccggc
aaaccttatacgacgggtgatttctgcatcggcaacgagaaatcgtttacgttcatggag
gatgtattgtccgaggtgatcgagttgttcccttccgaatatatccatatcgggggagac
gaggccgggaagggagcttggaagacctgcccgaaatgtcaaggcttgatgcgccggaac
gggatgaaggacgtggatgagttgcagagctatatgattcatcgtgccgaggaattcctg
atttccaaaggccgcaaattgatcggttgggatgagattctggaagggggcttggctccg
gaggctaccgtcatgtcttggcggggtgaggaagggggaatcaagtccgctcgcatggga
cacaacgtggtcatgacaccgggtggttatatgtatttcgatttctatcaagccgatccg
aagacacagccgtatgccatcggcggttatacgccgattaagcgggcgtacagttataat
ccggtgcctatggattcgttgactgccgaggaaagtaagcatatcctaggggtacaggcg
aatacatggacggagtatatcaaggatgagaagcatctggagtatatgatgttccctcgt
gccttggcggtcgccgagattggatggactccgcaagaggatcgtagttgggaggatttt
aagcctcgtatgaacgctaatatcccggttctgcaacggatgggtatccatacgttcacg
ctctcggacgagattgagaccacgatggaggtagataccttgcggcgagagatcaaggtc
atgttggatgcggagaaatatccggcggagatacgttacacgacagacggctctattccc
accgcctcttcccgggtctataacggcccgatcgtggtgaaagactccgctgatatcaag
gccgctatcttccgtgacgggcagcttcaaggaacgcctaccgagaagaaggtggattat
caccggggtatcaataagcctatacattataatagtaagctgtatagcggttatatggcg
ggtggcatgaacgccttgctggacggttacaggggaggcttgacttatctggacggtcgt
tggcagggttatttgaatgacttggattgcgtggtggacatgggcgaggtgacggatatc
cataaggtatcgtcccgctttatgcaattgatcggcccgggcgtgtaccaaccgggagag
gtggagttgctgacatcggaagacggggagagctatatctcgcagggagttatccctact
acgatatccaatacggataaagacctgtcttttcaggaatacacgtttaacggcgattgg
aaagcccgttatatccgtatcaaggcaaaagaggcgaataagggtttcatcttcacggat
gagatcgtgatctggtaa

DBGET integrated database retrieval system