KEGG   Parabacteroides distasonis: BDI_0688Help
Entry
BDI_0688          CDS       T00549                                 

Definition
lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pdi  Parabacteroides distasonis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pdi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BDI_0688
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BDI_0688
  Amino acid metabolism
   00310 Lysine degradation
    BDI_0688
Enzymes [BR:pdi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BDI_0688
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(818088..819422)
Genome map
AA seq 444 aa AA seqDB search
MATFEIKMPKLGESITEGTIISWSVKVGDTVEEDDVLFEVSTAKVSAEIPSPVEGKVKQL
LFNEGDTVAVGTVVAILEIEGEGEDNGAQPETSEATQPKEQVTAPASEELSKNSQEEDRW
YSPVVLQLAKTAGVSQDELDHIPGTGYLGRLSKKDIQTYIDHKNKGTEMPKPKQAPVSSM
QQTATSTPTITVAPPTAPSMPMTAATPSAPLAQGDEVREMDRVRKIIADHMVLSKKVSPH
VTSVIEVDVTRLVNWRKKVKDQFFKQEGINLTYMPAITEATAKALKAYPLVNSSVDGYNI
ILKKPINIGIAVSLNDGNLIVPVIHDADKLNLSGLASQIDTLAAKARENKLAPDSIQGGT
FTITNFGTFKSLFGTPIINQPQVAILAVGYIEKKPAVVETPEGDTIAIRHKMYLSLSYDH
RIVDGALAGAFLRSIADELENWNA
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggctacatttgagataaagatgcctaagttgggcgaaagtattacagaaggaaccatc
atctcatggtcggtaaaggtaggtgataccgtagaggaagatgatgtccttttcgaagta
agcacagcgaaagtaagcgctgagattccatcccccgttgagggaaaagtaaaacaactt
ctttttaatgagggagacaccgtagcggtcggtacagtcgtagcgatccttgagatcgaa
ggtgaaggagaggataacggagctcagccggaaacctcggaggctactcaaccgaaagaa
caagtcaccgctcccgcctcagaggaattatcaaagaattcccaagaggaagatcgttgg
tattctcccgtcgtattgcaattagcgaaaacggccggtgtatcgcaagatgaactggat
catattccgggtaccggatacctaggacgtctcagcaagaaagatattcaaacgtatatc
gatcacaaaaataaaggtacggaaatgccgaagccgaaacaggctcctgtttcttccatg
cagcaaacggctacgagcacgccaacaattacggtagcgccgccgaccgctccttccatg
cctatgacagcggccactccatccgctccactcgcccaaggagacgaggtgagagaaatg
gatcgtgtacgtaagatcattgcggaccatatggtattatcgaaaaaagtatctccgcat
gtgacgtcggttatcgaggtagacgtgacccgactggttaactggcgtaaaaaagtgaag
gatcaattcttcaagcaagaaggcatcaacctaacttatatgccggctattaccgaagcg
accgccaaagcgttgaaagcctatccattagtaaattcatccgtggacggttacaatatc
atcctaaagaagcctattaatataggtatagcggtttccttaaacgacggaaatttaatt
gtcccggttatacacgatgccgataagctgaacctaagtggcctcgcctcacaaatagat
accttggcggctaaagcccgtgagaataagctcgccccggatagcatccaaggcggaacg
ttcacgattacgaatttcggaaccttcaagagtctgttcggcaccccgatcatcaatcag
cctcaagtagcgatcctagccgtcggttatatcgagaagaagcctgcggtagtagagacg
cccgagggagacacgatcgctatccgtcacaagatgtacctctcactctcctacgatcat
cgtatcgtggacggagctttggcgggagcctttttacgttccatcgccgacgaactagag
aattggaacgcttaa

DBGET integrated database retrieval system