KEGG   Parabacteroides distasonis: BDI_0688Help
Entry
BDI_0688          CDS       T00549                                 

Definition
lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pdi  Parabacteroides distasonis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pdi01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:pdi00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:pdi00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(818088..819422)
Genome map
AA seq 444 aa AA seqDB search
MATFEIKMPKLGESITEGTIISWSVKVGDTVEEDDVLFEVSTAKVSAEIPSPVEGKVKQL
LFNEGDTVAVGTVVAILEIEGEGEDNGAQPETSEATQPKEQVTAPASEELSKNSQEEDRW
YSPVVLQLAKTAGVSQDELDHIPGTGYLGRLSKKDIQTYIDHKNKGTEMPKPKQAPVSSM
QQTATSTPTITVAPPTAPSMPMTAATPSAPLAQGDEVREMDRVRKIIADHMVLSKKVSPH
VTSVIEVDVTRLVNWRKKVKDQFFKQEGINLTYMPAITEATAKALKAYPLVNSSVDGYNI
ILKKPINIGIAVSLNDGNLIVPVIHDADKLNLSGLASQIDTLAAKARENKLAPDSIQGGT
FTITNFGTFKSLFGTPIINQPQVAILAVGYIEKKPAVVETPEGDTIAIRHKMYLSLSYDH
RIVDGALAGAFLRSIADELENWNA
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggctacatttgagataaagatgcctaagttgggcgaaagtattacagaaggaaccatc
atctcatggtcggtaaaggtaggtgataccgtagaggaagatgatgtccttttcgaagta
agcacagcgaaagtaagcgctgagattccatcccccgttgagggaaaagtaaaacaactt
ctttttaatgagggagacaccgtagcggtcggtacagtcgtagcgatccttgagatcgaa
ggtgaaggagaggataacggagctcagccggaaacctcggaggctactcaaccgaaagaa
caagtcaccgctcccgcctcagaggaattatcaaagaattcccaagaggaagatcgttgg
tattctcccgtcgtattgcaattagcgaaaacggccggtgtatcgcaagatgaactggat
catattccgggtaccggatacctaggacgtctcagcaagaaagatattcaaacgtatatc
gatcacaaaaataaaggtacggaaatgccgaagccgaaacaggctcctgtttcttccatg
cagcaaacggctacgagcacgccaacaattacggtagcgccgccgaccgctccttccatg
cctatgacagcggccactccatccgctccactcgcccaaggagacgaggtgagagaaatg
gatcgtgtacgtaagatcattgcggaccatatggtattatcgaaaaaagtatctccgcat
gtgacgtcggttatcgaggtagacgtgacccgactggttaactggcgtaaaaaagtgaag
gatcaattcttcaagcaagaaggcatcaacctaacttatatgccggctattaccgaagcg
accgccaaagcgttgaaagcctatccattagtaaattcatccgtggacggttacaatatc
atcctaaagaagcctattaatataggtatagcggtttccttaaacgacggaaatttaatt
gtcccggttatacacgatgccgataagctgaacctaagtggcctcgcctcacaaatagat
accttggcggctaaagcccgtgagaataagctcgccccggatagcatccaaggcggaacg
ttcacgattacgaatttcggaaccttcaagagtctgttcggcaccccgatcatcaatcag
cctcaagtagcgatcctagccgtcggttatatcgagaagaagcctgcggtagtagagacg
cccgagggagacacgatcgctatccgtcacaagatgtacctctcactctcctacgatcat
cgtatcgtggacggagctttggcgggagcctttttacgttccatcgccgacgaactagag
aattggaacgcttaa

DBGET integrated database retrieval system