KEGG   Parabacteroides distasonis: BDI_0688Help
Entry
BDI_0688          CDS       T00549                                 

Definition
lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pdi  Parabacteroides distasonis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pdi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BDI_0688
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BDI_0688
  Amino acid metabolism
   00310 Lysine degradation
    BDI_0688
Enzymes [BR:pdi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BDI_0688
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(818088..819422)
Genome map
AA seq 444 aa AA seqDB search
MATFEIKMPKLGESITEGTIISWSVKVGDTVEEDDVLFEVSTAKVSAEIPSPVEGKVKQL
LFNEGDTVAVGTVVAILEIEGEGEDNGAQPETSEATQPKEQVTAPASEELSKNSQEEDRW
YSPVVLQLAKTAGVSQDELDHIPGTGYLGRLSKKDIQTYIDHKNKGTEMPKPKQAPVSSM
QQTATSTPTITVAPPTAPSMPMTAATPSAPLAQGDEVREMDRVRKIIADHMVLSKKVSPH
VTSVIEVDVTRLVNWRKKVKDQFFKQEGINLTYMPAITEATAKALKAYPLVNSSVDGYNI
ILKKPINIGIAVSLNDGNLIVPVIHDADKLNLSGLASQIDTLAAKARENKLAPDSIQGGT
FTITNFGTFKSLFGTPIINQPQVAILAVGYIEKKPAVVETPEGDTIAIRHKMYLSLSYDH
RIVDGALAGAFLRSIADELENWNA
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggctacatttgagataaagatgcctaagttgggcgaaagtattacagaaggaaccatc
atctcatggtcggtaaaggtaggtgataccgtagaggaagatgatgtccttttcgaagta
agcacagcgaaagtaagcgctgagattccatcccccgttgagggaaaagtaaaacaactt
ctttttaatgagggagacaccgtagcggtcggtacagtcgtagcgatccttgagatcgaa
ggtgaaggagaggataacggagctcagccggaaacctcggaggctactcaaccgaaagaa
caagtcaccgctcccgcctcagaggaattatcaaagaattcccaagaggaagatcgttgg
tattctcccgtcgtattgcaattagcgaaaacggccggtgtatcgcaagatgaactggat
catattccgggtaccggatacctaggacgtctcagcaagaaagatattcaaacgtatatc
gatcacaaaaataaaggtacggaaatgccgaagccgaaacaggctcctgtttcttccatg
cagcaaacggctacgagcacgccaacaattacggtagcgccgccgaccgctccttccatg
cctatgacagcggccactccatccgctccactcgcccaaggagacgaggtgagagaaatg
gatcgtgtacgtaagatcattgcggaccatatggtattatcgaaaaaagtatctccgcat
gtgacgtcggttatcgaggtagacgtgacccgactggttaactggcgtaaaaaagtgaag
gatcaattcttcaagcaagaaggcatcaacctaacttatatgccggctattaccgaagcg
accgccaaagcgttgaaagcctatccattagtaaattcatccgtggacggttacaatatc
atcctaaagaagcctattaatataggtatagcggtttccttaaacgacggaaatttaatt
gtcccggttatacacgatgccgataagctgaacctaagtggcctcgcctcacaaatagat
accttggcggctaaagcccgtgagaataagctcgccccggatagcatccaaggcggaacg
ttcacgattacgaatttcggaaccttcaagagtctgttcggcaccccgatcatcaatcag
cctcaagtagcgatcctagccgtcggttatatcgagaagaagcctgcggtagtagagacg
cccgagggagacacgatcgctatccgtcacaagatgtacctctcactctcctacgatcat
cgtatcgtggacggagctttggcgggagcctttttacgttccatcgccgacgaactagag
aattggaacgcttaa

DBGET integrated database retrieval system