KEGG   Parabacteroides distasonis: BDI_0715Help
Entry
BDI_0715          CDS       T00549                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
pdi  Parabacteroides distasonis
Pathway
pdi00900  Terpenoid backbone biosynthesis
pdi01100  Metabolic pathways
pdi01110  Biosynthesis of secondary metabolites
pdi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pdi00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BDI_0715
Enzymes [BR:pdi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     BDI_0715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: ABR42485
UniProt: A6L9X1
Position
complement(847890..848705)
Genome map
AA seq 271 aa AA seqDB search
MICFPNAKINLGLNVVSKRPDGYHNIETIFYPIPVRDALEIVASDRTCFTQTGIPVDAPQ
EKNLVIKALNALKTRYEIPPLEIHLLKAIPFGAGLGGGSADAAFMLKLVNDFCGLDIHPD
ELEAIASTIGADCPFFIRNTPVFATGTGNQFEPVDLSLKDYYLCLVKPDVAVSTPEAYSM
VTPAAPETSLKEIIRLPVSEWKERMVNDFERSVFPRHPVIERIKDTLYEGGALYAAMSGS
GSSVFGLFEKPTHFKEQSLFSDCFLWEGQLS
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgatctgtttcccgaatgccaagataaacctaggtctgaacgtggtaagcaaacgtccg
gacggttatcataatatagagaccatcttctatccgatccccgtgagggatgccctcgag
atcgtcgcctcggatcggacctgtttcacgcaaaccggaatcccggtagacgctccccaa
gagaagaacctcgtcataaaagcactgaacgccctaaagacgagatacgagattcccccg
ctagagatccatttgttgaaagcgataccttttggcgccgggcttggaggaggttccgcc
gatgccgcttttatgttgaagctggtcaatgatttctgcggtttggatattcacccggat
gagttggaggcgatagcgtccaccatcggagccgattgcccgttctttatccgtaacacg
ccggtattcgcgaccggcacgggaaaccaattcgagcccgtggacttgtccttgaaggat
tattatctatgcttggtaaaaccggatgtagccgtctccacccccgaagcctattcgatg
gtaacacccgccgcgcccgagacctccttgaaagagatcatccggctaccggtatccgaa
tggaaagagcggatggtgaacgatttcgagcgaagcgtattcccgagacatcccgtgatc
gagcggatcaaggataccttatacgagggaggcgccttatatgccgccatgtccggctcc
ggatcgtccgtgttcggtttgttcgaaaaaccaacccatttcaaggaacaatccctgttc
agcgattgttttctatgggaaggacaattatcatga

DBGET integrated database retrieval system