KEGG   Parabacteroides distasonis: BDI_0715Help
Entry
BDI_0715          CDS       T00549                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
pdi  Parabacteroides distasonis
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:pdi00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(847890..848705)
Genome map
AA seq 271 aa AA seqDB search
MICFPNAKINLGLNVVSKRPDGYHNIETIFYPIPVRDALEIVASDRTCFTQTGIPVDAPQ
EKNLVIKALNALKTRYEIPPLEIHLLKAIPFGAGLGGGSADAAFMLKLVNDFCGLDIHPD
ELEAIASTIGADCPFFIRNTPVFATGTGNQFEPVDLSLKDYYLCLVKPDVAVSTPEAYSM
VTPAAPETSLKEIIRLPVSEWKERMVNDFERSVFPRHPVIERIKDTLYEGGALYAAMSGS
GSSVFGLFEKPTHFKEQSLFSDCFLWEGQLS
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgatctgtttcccgaatgccaagataaacctaggtctgaacgtggtaagcaaacgtccg
gacggttatcataatatagagaccatcttctatccgatccccgtgagggatgccctcgag
atcgtcgcctcggatcggacctgtttcacgcaaaccggaatcccggtagacgctccccaa
gagaagaacctcgtcataaaagcactgaacgccctaaagacgagatacgagattcccccg
ctagagatccatttgttgaaagcgataccttttggcgccgggcttggaggaggttccgcc
gatgccgcttttatgttgaagctggtcaatgatttctgcggtttggatattcacccggat
gagttggaggcgatagcgtccaccatcggagccgattgcccgttctttatccgtaacacg
ccggtattcgcgaccggcacgggaaaccaattcgagcccgtggacttgtccttgaaggat
tattatctatgcttggtaaaaccggatgtagccgtctccacccccgaagcctattcgatg
gtaacacccgccgcgcccgagacctccttgaaagagatcatccggctaccggtatccgaa
tggaaagagcggatggtgaacgatttcgagcgaagcgtattcccgagacatcccgtgatc
gagcggatcaaggataccttatacgagggaggcgccttatatgccgccatgtccggctcc
ggatcgtccgtgttcggtttgttcgaaaaaccaacccatttcaaggaacaatccctgttc
agcgattgttttctatgggaaggacaattatcatga

DBGET integrated database retrieval system