KEGG   Parabacteroides distasonis: BDI_0783Help
Entry
BDI_0783          CDS       T00549                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
pdi  Parabacteroides distasonis
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:pdi00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:pdi00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
916448..917776
Genome map
AA seq 442 aa AA seqDB search
MSYFKGEKEFFPGIGQIQFEGRESKNPLAFHYYDADKVVMGKTLKDHLRFAMAYWHTLCA
EGGDQFGGGTKTFPWNDSTDAITRAKYKMDAAFEFMTKCNIPYYCFHDVDVVDEAPTLGE
FEKRLQTMVEHAKEHQAATGKKLLWSTANVFGHKRYMNGAATNPYFPTVACVGTQIKNAI
DACIALGGENYVFWGGREGYMSLLNTNMKREKDHLAMMLTMARDYGRKNGFKGTFLIEPK
PMEPTKHQYDVDSETVIGFLRHYGLDKDFALNIEVNHATLAGHTFEHELQAAADAGMLCS
IDANRGDYQNGWDTDQFPMDIYELAQAWLVILEGGGLTTGGTNFDAKTRRNSTDLEDIFI
AHIGGMDAFARALMIAADILENSDYRKMRAERYASFDAGEGKAFEDGKLTLEDLRTIALR
DGEPKQISGKQELYEMIVNLHI
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgagttactttaaaggagagaaagaatttttcccgggaatcggacaaattcagtttgag
ggacgtgagtcaaaaaatccgttggcatttcattattatgacgcggataaggtagtaatg
ggtaagacactaaaggatcatttacgcttcgctatggcttattggcataccttatgtgct
gagggaggtgatcagtttggtggtggaacgaagacattcccttggaacgacagcacggac
gctatcacccgcgcgaagtacaagatggacgccgctttcgagtttatgaccaaatgtaat
attccttactattgcttccacgacgtggacgtggtggacgaggctcctacgctgggcgag
ttcgagaaacgtttgcagacgatggtggaacatgccaaggagcatcaagccgctaccgga
aagaaactgctatggtctaccgctaacgtgttcggacataagcgttatatgaacggtgcc
gctacgaacccttatttcccgaccgtggcatgcgtcggcacgcagatcaagaacgctatt
gacgcttgtatcgccttagggggcgagaactacgtgttctggggcggccgtgaggggtat
atgagcctattgaatacgaacatgaaacgtgagaaggatcatttagccatgatgttgacg
atggcccgtgattatggccgcaagaacggtttcaagggtacgttcctgatcgagccgaaa
ccgatggaaccgacgaaacatcaatatgacgtggattcggagaccgtgatcggcttcctt
cgccattatggattggacaaggatttcgccttgaatatcgaggtgaaccacgctaccttg
gccggacatacattcgagcatgaattgcaagccgccgccgacgccggcatgttgtgcagt
atcgacgcgaaccgtggcgattaccagaatggttgggatacggatcaattcccgatggat
atctatgagctggcacaggcttggctggttatccttgagggaggtggcttgactaccgga
ggtacgaacttcgacgccaagacccgccgtaattctacggacttggaggatatcttcatc
gctcatatcggtggtatggacgctttcgcccgtgccttgatgatcgccgccgatatcctt
gagaactcagactaccgcaagatgcgtgccgagcgttacgctagtttcgatgccggcgag
ggcaaggcattcgaggatggcaagcttacgctggaagatcttcgtacgatcgctttgcgt
gacggcgagccgaaacagatcagcggtaagcaggaattatacgagatgattgtaaatctg
catatctaa

DBGET integrated database retrieval system