KEGG   Parabacteroides distasonis: BDI_0912Help
Entry
BDI_0912          CDS       T00549                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
pdi  Parabacteroides distasonis
Pathway
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pdi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BDI_0912
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BDI_0912
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BDI_0912
Enzymes [BR:pdi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     BDI_0912
Exosome [BR:pdi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BDI_0912
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1046088..1047788)
Genome map
AA seq 566 aa AA seqDB search
MKKTLAFLLLLAIIIMPANAVEKENVKPVKNVILLIPDGTSLATISIARWLQWYQDPSKP
KLNIDPYLCGTVRTHSSNAPIGDSAPTTSCYMTGQPSRTGYVSTYPENDGDNDIYPTDPA
RAFQPLTTVLEAGKMLQGKATGLVFTCEFPHATPADCSAHSYNRGKYDWIAPQMVHNDID
VVIGGGVSILTKDMEDYLLANGYGVYRNDLKGMRADNNQKMWALYGNKEMAYDIDRNPEE
QPSIEEMTRKAIDKLSKNPNGFFLMVEGSKVDWAAHGNDPVGMATDFLAFDRACGAALEF
ARNNGETAVVIVPDHGNSGISLGRRDCKGYDKLTKDQLFHQFSLYKLTAEGFANKVNSVP
NSEVQNVFRTYAGFELTPEEMNALNNCKDYKNSPIPEDQRKPEDNSSMYSGSLTGLMAHI
ITSRTCFGFTTGGHTGEEVFLAAYHPQGTLPLGMNTNIELNEYLCNLFGLTHENLEDLTN
KNFARHTDVFEDYTCEIVPAADEKGSPTLIVKNKKDKKKQLTITPFSNIVKSGKKGQDEI
RLNSVVVYVDKNNTFYLPASLVDFLK
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaacattagcttttctgcttttgctggctattatcatcatgccggccaatgcc
gtggaaaaggagaacgtgaagcctgtcaagaacgtgatccttttaatcccggacggaacc
tcattggcgactatctctatcgcccgttggttgcaatggtaccaagatcccagcaaaccg
aaattgaacatcgacccgtatttgtgcggaacggtgcgtacgcattcttctaacgcccct
atcggcgactccgctcctactacatcatgctacatgaccggacaaccgagccgtacgggt
tatgtatccacttacccggagaacgacggtgataacgatatctacccgaccgacccggcc
cgtgccttccaaccgcttaccactgtattggaggctggaaagatgttgcagggcaaagcc
acgggattggttttcacttgcgaattcccgcacgctaccccggcggactgctccgctcat
agctacaaccgtggtaaatacgactggatcgctccgcagatggttcataatgatatcgat
gtcgttatcggtggtggagtttctatccttacaaaggatatggaagattatctattggcg
aacggatacggcgtatatagaaacgacctgaaaggtatgcgtgccgataataatcagaag
atgtgggctttatatggcaacaaggaaatggcttacgatatcgaccgcaatccggaagag
caaccttctatcgaggaaatgactcgtaaggcgatcgacaaattatccaagaacccgaat
ggcttcttcttaatggtagaaggcagtaaggtagactgggccgctcatggaaatgacccg
gtaggtatggctaccgatttcttggcattcgatcgtgcctgcggtgccgcattggagttc
gcacgcaataacggcgagactgccgttgtcatcgtacccgaccacggaaacagcggtatc
agcttaggtagaagagattgtaaaggttacgataaattgacgaaagatcaattgttccac
caattctccctgtataaattgaccgccgagggtttcgccaacaaggtaaacagcgttcct
aactcagaagtgcaaaacgtattccgcacctacgccggcttcgagctgacaccggaagag
atgaatgcgttgaacaattgcaaggattataagaatagcccgataccggaagaccaacgc
aaaccagaagataattcctccatgtacagtggctcgttaaccggattgatggcgcatatc
atcacttcccgcacttgcttcggtttcacgaccggcggccatacgggcgaggaagtattc
cttgccgcttaccatccgcaaggaaccttacccctaggtatgaatacgaacatcgagctg
aatgagtacttatgcaatttgttcggattgacacacgaaaacttggaagatcttacaaac
aagaacttcgcacgccacacggacgtattcgaggattacacttgcgagatcgtccctgcc
gccgacgagaaaggttctccaaccttgatcgttaagaacaagaaagataagaaaaaacag
ctaacgatcaccccgttctccaatatcgtgaagtccgggaagaaaggccaagatgagata
cggttaaactctgtcgtcgtttatgtcgataaaaataacacgttctatcttccggcaagt
ctagttgatttcttaaaataa

DBGET integrated database retrieval system