KEGG   Parabacteroides distasonis: BDI_0967Help
Entry
BDI_0967          CDS       T00549                                 

Gene name
hisD
Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
pdi  Parabacteroides distasonis
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pdi01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:pdi00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1122211..1123491
Genome map
AA seq 426 aa AA seqDB search
MEIIKYPGREEWSSLIKRPALDVTTLFDTVRTVLDEVREQGDIAVKAYEEKFDKVQLSSL
QVSEEEMREADALVAEDLKQAIRTAKANIEKFHASQRFEGKKVETTPGVTCWQKAVAIEK
VGLYIPGGTAPLFSTVLMLAVPARIAGCKEIVLCTPPNREGKVHPAILFAAEVAGVSKIF
KAGGIQAIAAMAYGTESVPKVYKIFGPGNQYVTAAKQLVSLKEVAIDMPAGPSEVEVIAD
ETANPDFIAADFLSQAEHGVDSQAILVTSSETIVKPVARAIQEQLDRLPRKEITEKSLAH
SRIIVLKDSREVVDFTNQYAPEHLIIQTSDYTAIAERIENAGSVFMGPYTPESAGDYASG
TNHTLPTNGYAKAYSGVNLDSFIKKITFQEITSDGIRALGSTIQTMAANEQLDAHRNAVT
IRLNTI
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggagattataaaatatcccggacgtgaggaatggagctcactaatcaaacgtcccgcg
ttggatgtaaccaccttgttcgatacggtccgtacggtattggacgaggtacgtgagcag
ggtgacatcgccgtaaaagcgtatgaggaaaagtttgataaggtgcagctttcttccctt
caagtctcggaagaggagatgcgggaagcggatgccttggtcgctgaggacttgaaacag
gcgatccgtacggcaaaggcgaatatcgagaagttccatgcctcgcagcgtttcgaggga
aagaaagtggagactaccccgggagtcacttgttggcagaaagcggtagcgattgagaaa
gtcggtttatatattccgggcggaacggcgcctttgttttccacggtattgatgttggca
gtgcccgcacgtatcgccggctgcaaggagatcgtattatgtacgccaccgaaccgggaa
gggaaagtacatcccgctatcctgttcgccgcagaggtcgcaggtgtaagtaagatattc
aaggctggaggaatccaagcgatagcggcgatggcctatgggacggaatcggtccccaag
gtgtataagatctttggccccggtaatcaatacgtgacggcggcaaagcaattagtaagc
ctgaaagaggtcgccattgatatgcccgccggaccatccgaggtagaggtgatcgcggac
gagacggcgaatcccgattttatcgccgccgatttcctctcgcaagccgaacatggggtg
gatagccaagcgatcctcgtaacctcttcggaaacgatcgtgaaacccgtggcccgtgcc
atccaagagcaactcgatcgtttgccccgaaaggagattaccgagaaatcattagcgcac
agccgtatcatcgtattgaaagattcgcgggaagtcgtagacttcacgaaccaatacgct
cccgagcacttgattatccaaacatcggattacaccgctatcgcggagcgaatcgagaac
gccggcagtgtctttatgggtccatatactccggaaagcgcaggcgattatgcttccggc
acgaatcataccttgccgaccaacggctatgccaaggcatatagcggcgtgaacttggat
agtttcatcaagaagatcactttccaagagatcacttccgatggtatccgtgccttgggt
agtacgatccaaaccatggcggccaacgagcagctggatgctcaccgcaacgcagtaaca
attagattgaacacgatatga

DBGET integrated database retrieval system