KEGG   Parabacteroides distasonis: BDI_1014Help
Entry
BDI_1014          CDS       T00549                                 

Definition
(GenBank) formate-tetrahydrofolate ligase
  KO
K01938  
formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
pdi  Parabacteroides distasonis
Pathway
One carbon pool by folate
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:pdi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    BDI_1014
Enzymes [BR:pdi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     BDI_1014
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1173123..1174790)
Genome map
AA seq 555 aa AA seqDB search
MKSDIEIARETDLRKIKEVATTLGIPREEVQNYGRYIAKVPIHLIDKKQMDQHNLILVTA
ITPTKAGIGKTTVSIGLALGLNKIGKKAVVALREPSLGPCFGMKGGAAGGGYAQVLPMEN
INLHFTGDFHAVTSAHNMITALLDNYIYQTRNTCEGLKEIKWKRVLDVNDRSLRNIVSGL
GGSANGVPTETGFDITPASEIMAILCLATDIEDLKRRVGNILLGYTNEDKPFTVNDLGIA
GAITVLLKDALLPNLVQTTENTPAFVHGGPFANIAHGCNSISATQMALTYGDYVITEAGF
GADLGAEKFFNIKCRKAGLSPKLTVIVATAQSLKLHGGVPEKEIKEPNIEGLKNGFANLD
KHIENMKSFGQQVIVTFNRFATDTDEEIALVAEHCEEKGVGFAMNNVFAEGGEGGTELAR
LVVDTIENHPSAPLQYTYDLNDPIRTKVQKVAQKIYGASSIVYTTLADKKLRQIESLGIS
HYPICIAKTQYSFSSDPKAYGVAKDFELKVRDVIINNGAEMIVVVMGEIMRMPGLPKEPQ
ARKIDIVDGMIEGLS
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcggacattgagatagcaagagaaacagacttgcgtaaaattaaggaagttgcg
acaacgttaggtatccctcgtgaggaagtacaaaattatggcaggtatattgccaaggtt
cctatccatttgatcgataaaaagcaaatggaccagcataatttaattttagtgaccgct
atcactcccactaaagcgggaatcggaaagactacggtttcgatcggtctggctttaggg
ctgaataaaatagggaagaaagcggtggtcgctttacgtgagccgtctcttggcccgtgt
ttcggcatgaaaggtggtgctgccggaggtggatatgcccaagtgcttcccatggaaaac
atcaacttgcattttacaggggattttcatgcggttacttccgcccacaatatgattacc
gctttattggataactatatttatcagacccgcaacacctgcgagggattgaaggagatc
aaatggaaacgggttcttgacgtaaacgaccgtagcttacgtaacatcgtatcgggtcta
ggcggctcggcgaacggtgtccctaccgagaccggatttgacatcactcccgcttcagag
atcatggcgatcctttgcttggctacggatatagaggatttgaaacgacgtgtcggaaat
attttattgggttatacaaacgaagataagcctttcacggtaaatgatcttggcatagcc
ggagctattaccgtattgctaaaagacgcattactgccgaaccttgtacaaacaacggag
aatactcccgcatttgtacatggaggtcctttcgctaatatcgcccatggatgtaattcc
atatcggccacccaaatggctcttacttatggagattatgtgattacggaggctggtttc
ggcgctgatctgggcgcagagaaattctttaatatcaaatgtagaaaagcggggctttca
ccgaaactgacagtcatcgtagcgactgcccagagcttgaaacttcatggtggcgttccg
gagaaagaaatcaaggaaccgaatatcgaaggattaaagaacggattcgctaacttagat
aaacacattgagaatatgaagagcttcggccagcaagtaatcgttactttcaaccgtttc
gctaccgatacggacgaggagattgcgttagtggctgagcattgcgaggagaaaggggtt
ggattcgccatgaataacgttttcgccgaaggcggtgaagggggtacggagcttgcccgc
ttagtggttgatacgatcgaaaatcatccttccgctcctttacaatatacatatgatctg
aatgatccgatccgtacgaaggtacaaaaagtggcccagaagatatacggagcttcttcg
attgtttatacgactttggccgataaaaaattgcgtcagatcgaaagcttgggtatttcc
cattatccgatctgtatcgccaagactcaatattcattctcttccgatccgaaagcttat
ggggtcgccaaagatttcgaactaaaagtacgagatgtaatcatcaataacggagccgag
atgatcgttgtcgtcatgggcgagatcatgcgtatgccgggactcccgaaagagccgcaa
gcccgaaagatcgatatcgtggatggcatgattgagggattgagttaa

DBGET integrated database retrieval system